Wikia

Proteins Wiki

At5g20720.2

Talk0
47,933pages on
this wiki

Redirected from CPN21

In the plant Arabidopsis thaliana, At5g20720.2 is a gene model for the locus At5g20720.[1]

Also known as CPN10, CHCPN10, ATCPN21, CPN21, and CPN20, this gene model is classified by TAIR as "CPN20 (CHAPERONIN 20); calmodulin binding". It is located on chr5, region 7015017-7016356 FORWARD.

Physiological functionEdit

At5g20720.2/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At5g20720.2/Expression

Subcellular localizationEdit

At5g20720.2/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At5g20720.2 has 253 amino-acid residues and a molecular weight Mw = 26.805 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is 3.10, or 0.012 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At5g20720.2/Knockout

Protein interactionsEdit

At5g20720.2/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At5g20720.2 has 2 recognized domains:

  • Domain_0061_0152 Cpn10 domain (PF00166, IPR001476) Description: Chaperonin Cpn10;Molecular Function: ATP binding (GO:0005524), Biological Process: protein folding (GO:0006457)
  • Domain_0159_0252 Cpn10 domain (PF00166, IPR001476) Description: Chaperonin Cpn10;Molecular Function: ATP binding (GO:0005524), Biological Process: protein folding (GO:0006457)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At5g20720.2
MAATQLTASP VTMSARSLAS LDGLRASSVK FSSLKPGTLR QSQFRRLVVK AASVVAPKYT SIKPLGDRVL VKIKEAEEKT LGGILLPSTA QSKPQGGEVV AVGEGRTIGK NKIDITVPTG AQIIYSKYAG TEVEFNDVKH LILKEDDIVG ILETEDIKDL KPLNDRVFIK VAEAEEKTAG GLLLTETTKE KPSIGTVIAV GPGSLDEEGK ITPLPVSTGS TVLYSKYAGN DFKGKDGSNY IALRASDVMA ILS
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Around Wikia's network

Random Wiki