Wikia

Proteins Wiki

At5g64300.1

Talk0
47,932pages on
this wiki

In the plant Arabidopsis thaliana, At5g64300.1 is a gene model for the locus At5g64300.[1]

Also known as ATGCH, this gene model is classified by TAIR as "ATGCH (Arabidopsis thaliana GTP cyclohydrolase II); 3,4-dihydroxy-2-butanone-4-phosphate synthase/ GTP cyclohydrolase II". It is located on chr5, region 25735685-25738016 FORWARD.

Physiological functionEdit

At5g64300.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At5g64300.1/Expression

Subcellular localizationEdit

At5g64300.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At5g64300.1 has 543 amino-acid residues and a molecular weight Mw = 59.042 kDa.

The protein is relatively acidic; at the physiological pH 7.4, its net charge is -12.21, or -0.022 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At5g64300.1/Knockout

Protein interactionsEdit

At5g64300.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At5g64300.1 has 2 recognized domains:

  • Domain_0131_0328 DHBP_synthase domain (PF00926, IPR000422) Description: 3,4-Dihydroxy-2-butanone 4-phosphate synthase;Molecular Function: 3,4-dihydroxy-2-butanone-4-phosphate synthase activity (GO:0008686), Biological Process: riboflavin biosynthesis (GO:0009231)
  • Domain_0333_0502 GTP_cyclohydro2 domain (PF00925, IPR000926) Description: GTP cyclohydrolase II;Molecular Function: GTP cyclohydrolase II activity (GO:0003935), Biological Process: riboflavin biosynthesis (GO:0009231)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At5g64300.1
MSSINLSSSS PSTISLSRSR LSQSSTTLLH GLHRVTLPSN HPLSTFSIKT NTGKVKAAVI SREDDLLSFT NGNTPLSNGS LIDDRTEEPL EADSVSLGTL AADSAPAPAN GFVAEDDDFE LDLPTPGFSS IPEAIEDIRQ GKLVVVVDDE DRENEGDLVM AAQLATPEAM AFIVRHGTGI VCVSMKEDDL ERLHLPLMVN QKENEEKLST AFTVTVDAKH GTTTGVSARD RATTILSLAS RDSKPEDFNR PGHIFPLKYR EGGVLKRAGH TEASVDLTVL AGLDPVGVLC EIVDDDGSMA RLPKLREFAA ENNLKVVSIA DLIRYRRKRD KLVERASAAR IPTMWGPFTA YCYRSILDGI EHIAMVKGEI GDGQDILVRV HSECLTGDIF GSARCDCGNQ LALSMQQIEA TGRGVLVYLR GHEGRGIGLG HKLRAYNLQD AGRDTVEANE ELGLPVDSRE YGIGAQIIRD LGVRTMKLMT NNPAKYVGLK GYGLAIVGRV PLLSLITKEN KRYLETKRTK MGHMYGLKFK GDVVEKIESE SES
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Around Wikia's network

Random Wiki