FANDOM


In the plant Arabidopsis thaliana, At5g62990.1 is a gene model for the locus At5g62990.[1]

Also known as EMB1692, this gene model is classified by TAIR as "EMB1692 (EMBRYO DEFECTIVE 1692)". It is located on chr5, region 25295054-25296538 FORWARD.

Physiological functionEdit

At5g62990.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At5g62990.1/Expression

Subcellular localizationEdit

At5g62990.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At5g62990.1 has 494 amino-acid residues and a molecular weight Mw = 56.788 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is 1.33, or 0.003 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At5g62990.1/Knockout

Protein interactionsEdit

At5g62990.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At5g62990.1 has 1 recognized domains:

  • Domain_0059_0401 DUF860 domain (PF05898, IPR008578) Description: Protein of unknown function DUF860, plant_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At5g62990.1
MMMALTQLVP SSPEKLFCFS SFFLPSIPLE IRRSNVTTKT SSKKLGSLSL NISCSAHKIV RSPSLDRHVV KQNRVRFVQK LNTLLLSKPK HYIPIEILYK CRSYLCIENP LAILSMIRRY PTIFELFTTP TPHLPMNATK PLSQLCVRLT SAASSLAMQE LNLKSEISDK LATKLQKLLM LSSHRRLLLS KLVHIAPDFG FPPNFRSRLC NDYPDKFKTV DTSYGRALEL VSSDPELANQ MPSPEVDRGL IVDRPLKFKR LNLRRGLNLK RRHQGFLIKF RESPDVCPYK MSSDYLASES IEAEKRACAV VREVLGLTVE KRTLIDHLTH FRKEFSLPNK LRDLIVRHPE LFYVSIKGMR DSVFLVEAYN DNGDLLDKDE RLVIRERLID LIQEGKRIRR ERRRKGATLG DKSVEEKRKD DETIDDYDSD LDDEYEDGFE NLFDSEDLGV EYHFDEEDDD DEAGVNGESV EYWSRKLSSS GSSSDEANSA VESW
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.