Wikia

Proteins Wiki

At5g51990.1

Talk0
47,932pages on
this wiki

In the plant Arabidopsis thaliana, At5g51990.1 is a gene model for the locus At5g51990.[1]

Also known as CBF4, and DREB1D, this gene model is classified by TAIR as "CBF4/DREB1D (C- REPEAT-BINDING FACTOR 4); DNA binding / transcription factor/ transcriptional activator". It is located on chr5, region 21134339-21135013 REVERSE.

Physiological functionEdit

At5g51990.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At5g51990.1/Expression

Subcellular localizationEdit

At5g51990.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At5g51990.1 has 224 amino-acid residues and a molecular weight Mw = 24.951 kDa.

The protein is relatively acidic; at the physiological pH 7.4, its net charge is -5.11, or -0.023 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At5g51990.1/Knockout

Protein interactionsEdit

At5g51990.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At5g51990.1 has 1 recognized domains:

  • Domain_0052_0115 AP2 domain (PF00847, IPR001471) Description: Pathogenesis-related transcriptional factor and ERF;Molecular Function: transcription factor activity (GO:0003700), Cellular Component: nucleus (GO:0005634), Biological Process: regulation of transcription, DNA-dependent (GO:0006355)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At5g51990.1
MNPFYSTFPD SFLSISDHRS PVSDSSECSP KLASSCPKKR AGRKKFRETR HPIYRGVRQR NSGKWVCEVR EPNKKSRIWL GTFPTVEMAA RAHDVAALAL RGRSACLNFA DSAWRLRIPE TTCPKEIQKA ASEAAMAFQN ETTTEGSKTA AEAEEAAGEG VREGERRAEE QNGGVFYMDD EALLGMPNFF ENMAEGMLLP PPEVGWNHND FDGVGDVSLW SFDE
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Advertisement | Your ad here

Around Wikia's network

Random Wiki