FANDOM


In the plant Arabidopsis thaliana, At5g51020.1 is a gene model for the locus At5g51020.[1]

This gene model is classified by TAIR as "similar to Protein of unknown function DUF1001 [Medicago truncatula] (GB:ABE80209.1); contains InterPro domain Protein of unknown function DUF1001; (InterPro:IPR010404)". It is located on chr5, region 20762786-20764391 REVERSE.

Physiological functionEdit

At5g51020.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At5g51020.1/Expression

Subcellular localizationEdit

At5g51020.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At5g51020.1 has 269 amino-acid residues and a molecular weight Mw = 30.329 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is -1.45, or -0.005 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At5g51020.1/Knockout

Protein interactionsEdit

At5g51020.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At5g51020.1 has 1 recognized domains:

  • Domain_0042_0236 DUF1001 domain (PF06206, IPR010404) Description: Protein of unknown function DUF1001_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At5g51020.1
MGTESGSDPE SSSNGWSRAR GLVVKTLVLI GGALLIKRLT KSTTRRDHAR VVSRSLTGEK FTREQASRDP DNYFNIRMLS CPAAEMVDGS EVLYLEQAFW RTPQKPFRQR LYMVKPCPKE LKCDVEVSSY AIRDAEEYKN FCDRPKDQRP LPEEVIGDIG EHLTTIHLNC CDRGKRCLYE GSTSPGGFPN SWNGASYCTS DLAVLKNNEI HLWDRGFDEN RNQVWGPKEG PYEFKPATSS SINENLSALN ILYQSSIDKP IQGSLILQD
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.