Wikia

Proteins Wiki

At5g16620.2

Talk0
47,919pages on
this wiki

In the plant Arabidopsis thaliana, At5g16620.2 is a gene model for the locus At5g16620.[1]

Also known as TIC40, ATTIC40, and PDE120, this gene model is classified by TAIR as "PDE120 (PIGMENT DEFECTIVE EMBRYO); heme binding". It is located on chr5, region 5450811-5454259 FORWARD.

Physiological functionEdit

At5g16620.2/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At5g16620.2/Expression

Subcellular localizationEdit

At5g16620.2/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At5g16620.2 has 447 amino-acid residues and a molecular weight Mw = 48.899 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is -4.45, or -0.010 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At5g16620.2/Knockout

Protein interactionsEdit

At5g16620.2/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At5g16620.2 has no known domains._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At5g16620.2
MENLTLVSCS ASSPKLLIGC NFTSSLKNPT GFSRRTPNIV LRCSKISASA QSQSPSSRPE NTGEIVVVKQ RSKAFASIFS SSRDQQTTSV ASPSVPVPPP SSSTIGSPLF WIGVGVGLSA LFSYVTSNLK KYAMQTAMKT MMNQMNTQNS QFNNSGFPSG SPFPFPFPPQ TSPASSPFQS QSQSSGATVD VTATKVETPP STKPKPTPAK DIEVDKPSVV LEASKEKKEE KNYAFEDISP EETTKESPFS NYAEVSETNS PKETRLFEDV LQNGAGPANG ATASEVFQSL GGGKGGPGLS VEALEKMMED PTVQKMVYPY LPEEMRNPET FKWMLKNPQY RQQLQDMLNN MSGSGEWDKR MTDTLKNFDL NSPEVKQQFN QIGLTPEEVI SKIMENPDVA MAFQNPRVQA ALMECSENPM NIMKYQNDKE VMDVFNKISQ LFPGMTG
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Around Wikia's network

Random Wiki