Fandom

Proteins Wiki

At4g10500.1

47,922pages on
this wiki
Add New Page
Talk0 Share

In the plant Arabidopsis thaliana, At4g10500.1 is a gene model for the locus At4g10500.[1]

This gene model is classified by TAIR as "oxidoreductase, 2OG-Fe(II) oxygenase family protein". It is located on chr4, region 6491085-6492338 FORWARD.

Physiological functionEdit

At4g10500.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At4g10500.1/Expression

Subcellular localizationEdit

At4g10500.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At4g10500.1 has 349 amino-acid residues and a molecular weight Mw = 39.223 kDa.

The protein is relatively acidic; at the physiological pH 7.4, its net charge is -10.11, or -0.029 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At4g10500.1/Knockout

Protein interactionsEdit

At4g10500.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At4g10500.1 has 1 recognized domains:

  • Domain_0197_0296 2OG-FeII_Oxy domain (PF03171, IPR005123) Description: 2OG-Fe(II) oxygenase_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At4g10500.1
MATSAISKLL VSDFASSVHI PSNYVRPISD RPNLSEVESS GDSIPLIDLR DLHGPNRAVI VQQLASACST YGFFQIKNHG VPDTTVNKMQ TVAREFFHQP ESERVKHYSA DPTKTTRLST SFNVGADKVL NWRDFLRLHC FPIEDFIEEW PSSPISFREV TAEYATSVRA LVLRLLEAIS ESLGLESDHI SNILGKHAQH MAFNYYPPCP EPELTYGLPG HKDPTVITVL LQDQVSGLQV FKDDKWVAVS PIPNTFIVNI GDQMQVISND KYKSVLHRAV VNTENERLSI PTFYFPSTDA VIGPAHELVN EQDSLAIYRT YPFVEYWDKF WNRSLATASC LDAFKAPTT
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.