Wikia

Proteins Wiki

At3g59400.1

Talk0
47,933pages on
this wiki

In the plant Arabidopsis thaliana, At3g59400.1 is a gene model for the locus At3g59400.[1]

Also known as GUN4, this gene model is classified by TAIR as "GUN4 (Genomes uncoupled 4)". It is located on chr3, region 21959858-21960655 REVERSE.

Physiological functionEdit

At3g59400.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At3g59400.1/Expression

Subcellular localizationEdit

At3g59400.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At3g59400.1 has 265 amino-acid residues and a molecular weight Mw = 29.663 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is -0.89, or -0.003 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At3g59400.1/Knockout

Protein interactionsEdit

At3g59400.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At3g59400.1 has 1 recognized domains:

  • Domain_0084_0227 GUN4 domain (PF05419, IPR008629) Description: GUN4-like_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At3g59400.1
MATTNSLHHH HHSSPSYTHH RNNLHCQSHF GPTSLSLKQP TSAATFSLIC SASSTSSSTT AVSAVSTTNA SATTAETATI FDVLENHLVN QNFRQADEET RRLLIQISGE AAVKRGYVFF SEVKTISPED LQAIDNLWIK HSDGRFGYSV QRKIWLKVKK DFTRFFVKVE WMKLLDTEVV QYNYRAFPDE FKWELNDETP LGHLPLTNAL RGTQLLKCVL SHPAFATADD NSGETEDELN RGVAVAKEQA GVGADKRVFK TNYSF
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Around Wikia's network

Random Wiki