Wikia

Proteins Wiki

At3g27180.1

47,920pages on
this wiki
Talk0

In the plant Arabidopsis thaliana, At3g27180.1 is a gene model for the locus At3g27180.[1]

This gene model is classified by TAIR as "similar to Os01g0920300 [Oryza sativa (japonica cultivar-group)] (GB:NP_001045219.1); similar to putative 23S rRNA (Uracil-5-)-methyltransferase [Candidatus Protochlamydia amoebophila UWE25] (GB:YP_008997.1); contains domain RNA M5U METHYLTRANSFERASE FAMILY (PTHR11061); contains domain no description (G3D.3.40.50.150); contains domain gb def: Emb:CAB12631.1 (PTHR11061:SF5); contains domain S-adenosyl-L-methionine-dependent methyltransferases (SSF53335)". It is located on chr3, region 10028400-10031299 REVERSE.

Physiological functionEdit

At3g27180.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At3g27180.1/Expression

Subcellular localizationEdit

At3g27180.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At3g27180.1 has 518 amino-acid residues and a molecular weight Mw = 57.862 kDa.

The protein is relatively basic; at the physiological pH 7.4, its net charge is 17.22, or 0.033 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At3g27180.1/Knockout

Protein interactionsEdit

At3g27180.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At3g27180.1 has no known domains._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At3g27180.1
MMNSSSLFSF GGRFPIINCR VSAPASAPFV ASVPLPPSTS SDSLACSLQC PHFQSCSGCT QEFNLHRPAV VDEASDFFKR YGVDDFTFDS CRLWGWRCRA KLAVRGSSDN ALIGLYQEGT HTVVDIPECK SHHPNINAAI ELLREGIKVF DVVPFDEDQG TGDLRYVQMA VTTHSTNLRA PERYKNGKVQ VSLVWNSRNE RSHNADKLQA LSTYLWRKGG PNSKFHLIHS VWANFQTSTN NIIFGNRWRH LLGERDFWEH VGGIDISLDP SSFGQANTRA FDSLLWKLHK YVPGGSSVAD LYAGAGVIGL SLATSRKCSS VKCIEVNKEA RLSFEKTIQR LPNSLNCSIS WHHADASVNP LSWIIGSDVV VVDPPRRGLD ASLRQMLESV PSIEKRMRSS SQSSSLNAKE EKRPWILRAK ELSIQAGNKQ TSEENNTLPQ RLIYISCGWE SFKEDCKSLL SSRAWELEKA HGFNFFPGTD SIEVLAVFKR RVASKKKKKS GIKKVGIKKV RAKSQDSY
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Around Wikia's network

Random Wiki