FANDOM


In the plant Arabidopsis thaliana, At3g14930.2 is a gene model for the locus At3g14930.[1]

Also known as HEME1, this gene model is classified by TAIR as "HEME1; uroporphyrinogen decarboxylase". It is located on chr3, region 5020682-5022584 FORWARD.

Physiological functionEdit

At3g14930.2/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At3g14930.2/Expression

Subcellular localizationEdit

At3g14930.2/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At3g14930.2 has 418 amino-acid residues and a molecular weight Mw = 46.252 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is -1.56, or -0.004 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At3g14930.2/Knockout

Protein interactionsEdit

At3g14930.2/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At3g14930.2 has 1 recognized domains:

  • Domain_0057_0397 URO-D domain (PF01208, IPR000257) Description: Uroporphyrinogen decarboxylase (URO-D);Molecular Function: uroporphyrinogen decarboxylase activity (GO:0004853), Biological Process: porphyrin biosynthesis (GO:0006779)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At3g14930.2
MSLSSPTSAC SSSRCYSSGL SFPIGFGSNP INVGLVCYPK RYSIAARKFV VACSSSSSDP LLVKAAKGQA ISRPPAWMMR QAGRYMAVYQ KLAKKHPSFR ERSENTDLIV EISLQPWQAF RPDGVIIFSD ILTPLPAFGV PFDIEEVKGP VIQSPIRTEE DMKRLHPIDF EKLQFVGDSL KILRREVGEH AAVLGFVGAP WTIATYIVEG GTTRTYTVIK NMCHTAPDVL RALLSHLTKA ITEYVVYQVE HGAHCIQIFD SWGGQLTPEM WERWSKPYIE EIIHAVKKRC PDTPIVFYIN GNGGLLERMK GTGADVIGLD WTVDMADGRR RLGSEVSVQG NVDPAYLFSP LPALTEEIER VVKCAGPKGH ILNLGHGVLV GTPEEAVAHF FETARNLDYQ TLFQNHVPAE KAEPELVV
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit