Wikia

Proteins Wiki

At2g44500.2

Talk0
47,922pages on
this wiki

In the plant Arabidopsis thaliana, At2g44500.2 is a gene model for the locus At2g44500.[1]

This gene model is classified by TAIR as "similar to unknown protein [Arabidopsis thaliana] (TAIR:AT3G07900.1); similar to Plant protein family, putative [Medicago truncatula] (GB:ABE79402.1); contains InterPro domain Protein of unknown function DUF246, plant; (InterPro:IPR004348)". It is located on chr2, region 18381523-18382979 FORWARD.

Physiological functionEdit

At2g44500.2/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At2g44500.2/Expression

Subcellular localizationEdit

At2g44500.2/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At2g44500.2 has 422 amino-acid residues and a molecular weight Mw = 47.858 kDa.

The protein is relatively basic; at the physiological pH 7.4, its net charge is 17.21, or 0.041 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At2g44500.2/Knockout

Protein interactionsEdit

At2g44500.2/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At2g44500.2 has 1 recognized domains:

  • Domain_0182_0416 DUF246 domain (PF03138, IPR004348) Description: Protein of unknown function DUF246, plant_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At2g44500.2
MALSKNSNSN SFNKKKVSYI SVPSQIINSL SSSSLQSLLV SPKKSSRSTN RFSFSYRNPR IWFFTLFLVS LFGMLKLGFN VDPISLPFSR YPCSTTQQPL SFDGEQNAAS HLGLAQEPIL STGSSNSNAI IQLNGGKNET LLTEGDFWKQ PDGLGFKPCL GFTSQYRKDS NSILKNRWKY LLVVVSGGMN QQRNQIVDAV VIARILGASL VVPVLQVNVI WGDESEFADI FDLEHFKDVL ADDVHIVSSL PSTHVMTRPV EEKRTPLHAS PQWIRAHYLK RINRERVLLL RGLDSRLSKD LPSDLQKLRC KVAFQALRFS PRILELGNKL ASRMRNQGQY LSLHLRMEKD VWVRTGCLPG LTPEYDEIVN SERERHPELL TGRSNMTYHE RKLAGLCPLT ALEVTRYYTN SMNKSFCLCF FK
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Around Wikia's network

Random Wiki