Wikia

Proteins Wiki

At2g39730.3

Talk0
47,932pages on
this wiki

In the plant Arabidopsis thaliana, At2g39730.3 is a gene model for the locus At2g39730.[1]

Also known as RCA, this gene model is classified by TAIR as "RCA (RUBISCO ACTIVASE)". It is located on chr2, region 16578252-16580423 REVERSE.

Physiological functionEdit

At2g39730.3/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At2g39730.3/Expression

Subcellular localizationEdit

At2g39730.3/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At2g39730.3 has 441 amino-acid residues and a molecular weight Mw = 48.501 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is 0.76, or 0.002 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At2g39730.3/Knockout

Protein interactionsEdit

At2g39730.3/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At2g39730.3 has 1 recognized domains:

  • Domain_0160_0358 AAA domain (PF00004, IPR003959) Description: AAA ATPase, central region;Molecular Function: ATP binding (GO:0005524)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At2g39730.3
MAAAVSTVGA INRAPLSLNG SGSGAVSAPA STFLGKKVVT VSRFAQSNKK SNGSFKVLAV KEDKQTDGDR WRGLAYDTSD DQQDITRGKG MVDSVFQAPM GTGTHHAVLS SYEYVSQGLR QYNLDNMMDG FYIAPAFMDK LVVHITKNFL TLPNIKVPLI LGIWGGKGQG KSFQCELVMA KMGINPIMMS AGELESGNAG EPAKLIRQRY REAADLIKKG KMCCLFINDL DAGAGRMGGT TQYTVNNQMV NATLMNIADN PTNVQLPGMY NKEENARVPI ICTGNDFSTL YAPLIRDGRM EKFYWAPTRE DRIGVCKGIF RTDKIKDEDI VTLVDQFPGQ SIDFFGALRA RVYDDEVRKF VESLGVEKIG KRLVNSREGP PVFEQPEMTY EKLMEYGNML VMEQENVKRV QLAETYLSQA ALGDANADAI GRGTFYGKTE V
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Advertisement | Your ad here

Around Wikia's network

Random Wiki