Fandom

Proteins Wiki

At2g39660.1

47,923pages on
this wiki
Add New Page
Talk0 Share

In the plant Arabidopsis thaliana, At2g39660.1 is a gene model for the locus At2g39660.[1]

Also known as BIK1, this gene model is classified by TAIR as "BIK1 (BOTRYTIS-INDUCED KINASE1); kinase". It is located on chr2, region 16539021-16540679 FORWARD.

Physiological functionEdit

At2g39660.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At2g39660.1/Expression

Subcellular localizationEdit

At2g39660.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At2g39660.1 has 395 amino-acid residues and a molecular weight Mw = 44.109 kDa.

The protein is relatively basic; at the physiological pH 7.4, its net charge is 12.54, or 0.032 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At2g39660.1/Knockout

Protein interactionsEdit

At2g39660.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At2g39660.1 has 1 recognized domains:

  • Domain_0067_0349 Pkinase domain (PF00069, IPR000719) Description: Protein kinase;Molecular Function: protein kinase activity (GO:0004672), Molecular Function: ATP binding (GO:0005524), Biological Process: protein amino acid phosphorylation (GO:0006468)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At2g39660.1
MGSCFSSRVK ADIFHNGKSS DLYGLSLSSR KSSSTVAAAQ KTEGEILSST PVKSFTFNEL KLATRNFRPD SVIGEGGFGC VFKGWLDEST LTPTKPGTGL VIAVKKLNQE GFQGHREWLT EINYLGQLSH PNLVKLIGYC LEDEHRLLVY EFMQKGSLEN HLFRRGAYFK PLPWFLRVNV ALDAAKGLAF LHSDPVKVIY RDIKASNILL DADYNAKLSD FGLARDGPMG DLSYVSTRVM GTYGYAAPEY MSSGHLNARS DVYSFGVLLL EILSGKRALD HNRPAKEENL VDWARPYLTS KRKVLLIVDN RLDTQYLPEE AVRMASVAVQ CLSFEPKSRP TMDQVVRALQ QLQDNLGKPS QTNPVKDTKK LGFKTGTTKS SEKRFTQKPF GRHLV
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.