Wikia

Proteins Wiki

At2g22250.2

Talk0
47,933pages on
this wiki

In the plant Arabidopsis thaliana, At2g22250.2 is a gene model for the locus At2g22250.[1]

Also known as ATAAT, AAT, and MEE17, this gene model is classified by TAIR as "AAT/ATAAT/MEE17 (maternal effect embryo arrest 17); aspartate transaminase". It is located on chr2, region 9465091-9467377 REVERSE.

Physiological functionEdit

At2g22250.2/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At2g22250.2/Expression

Subcellular localizationEdit

At2g22250.2/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At2g22250.2 has 475 amino-acid residues and a molecular weight Mw = 51.001 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is 1.65, or 0.003 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At2g22250.2/Knockout

Protein interactionsEdit

At2g22250.2/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At2g22250.2 has 1 recognized domains:

  • Domain_0099_0462 Aminotran_1_2 domain (PF00155, IPR004839) Description: Aminotransferase, class I and II;Biological Process: biosynthesis (GO:0009058), Molecular Function: transferase activity, transferring nitrogenous groups (GO:0016769)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At2g22250.2
MASQSSVAVI SSAAARGESF PDSKKPIGSV RFQQPLRLSF SYCKSGNMSS RICAMAKPND AETLSSSVDM SLSPRVQSLK PSKTMVITDL AATLVQSGVP VIRLAAGEPD FDTPKVVAEA GINAIREGFT RYTLNAGITE LREAICRKLK EENGLSYAPD QILVSNGAKQ SLLQAVLAVC SPGDEVIIPA PYWVSYTEQA RLADATPVVI PTKISNNFLL DPKDLESKLT EKSRLLILCS PSNPTGSVYP KSLLEEIARI IAKHPRLLVL SDEIYEHIIY APATHTSFAS LPDMYERTLT VNGFSKAFAM TGWRLGYLAG PKHIVAACSK LQGQVSSGAS SIAQKAGVAA LGLGKAGGET VAEMVKAYRE RRDFLVKSLG DIKGVKISEP QGAFYLFIDF SAYYGSEAEG FGLINDSSSL ALYFLDKFQV AMVPGDAFGD DSCIRISYAT SLDVLQAAVE KIRKALEPLR ATVSV
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Around Wikia's network

Random Wiki