FANDOM


>gi|30679289|ref|NP_849956.1|	   93 residues, 50 /line  unknown protein [Arabidopsis thaliana]
MAWRNAGSAARSFVSATARSPSLRSPTTALPRLRPPQSSLPSRRFTFSSPSRNLGALGCT
QSFLPLYSVVATSQLTSHLNVNLRAFCELSNGT----
>gi|42567379|ref|NP_567963.3|	   94 residues, 50 /line  unknown protein [Arabidopsis thaliana]
MAWR---SAARSFVSATARAPSLRSPPPTLPRLRPSQSSLPRRRFASFTNPRNLGELGCT
ESFLPLYNVVAAARLTSHLNVNLRAFCELSNGNGKDG
>gi|42573167|ref|NP_974680.1|	   90 residues, 50 /line  unknown protein [Arabidopsis thaliana]
MAWR---SAARSFVSATARAPSLRSPPPTLPRLRPSQSSLPRRRFASFTNPRNLGELGCT
ESFLPLYNVVAAARLTSHLNVNLRAFCELSNGT----
>gi|18397688|ref|NP_565368.1|	   97 residues, 50 /line  unknown protein [Arabidopsis thaliana]
MAWRNAGSAARSFVSATARSPSLRSPTTALPRLRPPQSSLPSRRFTFSSPSRNLGALGCT
QSFLPLYSVVATSQLTSHLNVNLRAFCELSNGIGKDG

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.