Fandom

Proteins Wiki

At2g14910.2/MSA

< At2g14910.2

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|42570781|ref|NP_973464.1|	   366 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------MATTTLSSFSLSLPQLL--HKPTKPLPFLFLLPRFN----------RR
FRSLTITS----------------------------------------------------
------------------------------------------SSTTSSNNFSSNCG----
------------------------------------------------------------
------------------------------------------------------------
--DDGFSLD--------------------------------------------------D
FTLHSDSRSPKK---CVLSDLIQEIEP-LDVSLIQKDV-PVTTLDAMKRTISGMLGLLPS
---DRFQ-VHIESLWEPLSKLLVSSMMTG-------------------------------
-------------------YTLRNAEYRLFLEKNLDMSGGGLDSHASENTE---YDMEGT
FP----------------------------------------------------------
-----------------------DE-DHVSSKRDSRTQNLSETIDEEGLGRVSSEAQEYI
LRLQSQLSSVKK------ELQEMRRKNAALQM---QQFVGEEKNDLLDYLRSLQPEKVAE
LS------------------------------EPAAPEVKETIHSVVHGLLATLS--PKM
HSKFPASEVPPTET-------VK--A-KSDEDC----------------------AELVE
NTSLQFQPLISLTRDY-LARLLF-------------------------------------
--------------------------------------------------------WLEE
LPS-----------STSLSLA--------------------------C
>gi|108862884|gb|ABA99135.2|	   420 residues, 50 /line  seed maturation protein PM23, putative, expressed [Oryza sativa (japonica cultivar-group)]
------------MPISSGILAPTRGASSSSSAVGRKLLLLGARHPP--------------
SSVA------VAGRGVWRRGLAGVGVAA--------------------------------
------------------------------------------AAASSSSPDELHARGRPL
RGG---------------------------------------------------------
--------AYEEVSERAQPRGLNSMFLLH-------------------------------
------------------------------------------------------------
-VIRNRRIEAKR---SALWNLIKDIEP-LDLSIIQKDV-PSETVDAMKRTVSGMLGLLPS
---DQFH-VVIESLWNPFFKLLASSIMTG-------------------------------
-------------------YTLFNAQYRLSLERTLEFSEEETECKKRDSCEEIH---SVG
RP----------------------------------------------------------
----------------SMFLSLPEDVGLTIESEMADEKL-CGNM--DGLGSLSIEAKKLI
LGMQSRLDSMEK------ELHELKKKNSSQQM---QQFAGEEKNELLYYLRSLSPEKVVE
LS------------------------------ESSCPGVEEAVYSVVHGLLATLS--PKM
HTNRSPTSENMAGG-------AVNFGMEEDDEF----------------------TELVE
DVSLPFQPLISIPRDR-LARLLF-------------------------------------
--------------------------------------------------------WCMM
LGHYIRGQECRLELMHLLAVSSDAHS----------------------
>gi|110224762|emb|CAL07981.1|	   273 residues, 50 /line  hypothetical protein [Platanus x acerifolia]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------RRIAEVKANERRKALEEILYALVVQKFMDADVSLMP---TISPSSATDASTQ-
------------------------------------------------------------
----------------------VGTWP-GQEEKLKQLHS-PEAYEMIQNHLALILGNRV-
---ANSN-TVAQISKLRVGQVYAASVMYG-------------------------------
-------------------YFLKRVDQRFQLEKTMKILPFASDEEKSD------------
-IEQSVAEEMRPGG---GKASAYAEQTHPEVSSQPGN---------------------FS
PG-GFGHGIKPS---------------------RLRTY-VMAFDAETLQSYATIRSKEAV
TIIEKHTEALFG------R-----PEIVITPQ---GTID--SSK----------------
------------------------------------------------------------
------------------------------------------------------------
------DELVRISFGG-LKRLVL-------------------------------------
--------------------------------------------------------EAVT
FGSFLWDVESYVDSR---------------------------------
>gi|147854215|emb|CAN79123.1|	   411 residues, 50 /line  hypothetical protein [Vitis vinifera]
----------MEAAIATVVPSSLGFSRATNFR-------SRST---VFNVNGYLNL-KSH
SRPGHR--------------------KMAS------------------------GWKEQT
-MVRAX-ATVD-NDSY---ESAAXIAPLRLESPIGRFLT-------------------EI
LI---------SHPHLVPAAVERQLEQFQTDRDAEGH----------------KQESSAS
GIELLLYRRIAKVKANERKKALEEILYVLVVQKFVGANVPLIP---RMSPSS-LGSSGR-
------------------------------------------------------------
----------------------VDNWP-SLDRDLGELHS-PEATEMIQNHLAFILGNRF-
---GDST-SVAKMSKLRVGQVYAASVMYG-------------------------------
-------------------YFLKRVDERFQLEKTMKILPYALDGDKGY------------
-VEEAMGMS--PFG---SDDSVQGVESQPEASCWAGG---------------------LT
IG-SFGHWKKPS---------------------SLGSY-VKLIDAETLMRYTTIRSMEAV
SIIQKHTQALFG------R-----RDVAIIPNIPMWTLD--SSE----------------
------------------------------------------------------------
------------------------------------------------------------
------DELIKMSFGG-LKRLVL-------------------------------------
--------------------------------------------------------EALT
FGSFLWDVESFVDSRLHFVVN---------------------------
>gi|125545521|gb|EAY91660.1|	   413 residues, 50 /line  hypothetical protein OsI_012893 [Oryza sativa (indica cultivar-group)]
----------MEAAAAAAAALLSPPAAAAPSR---------------RPGTPGA---TSL
PFARRR----------------------GV----------AAVKGLGRQQLT--CRRRGV
-VVRAAS-WSPSGPESLPPPPSSSIAPLQMESPVGQFLS-------------------QI
LA---------THPHLLPAAAEQQLEQLQTDRDAAKD-------------NGGDKP-APS
DGDIVLYRRIAEVKEKERKRALEEILYALVVQKFVEAGVSLVP---ALSHSI--SSSGR-
------------------------------------------------------------
----------------------VDQWAESVEGKLEKMHS-QEAYEMIENHLALILGQRQ-
---AD-A-TVAAISKLRVGQVYAASVMYG-------------------------------
-------------------YFLKRVDQRFQLEKSMKTLPWGSEEE-DK------------
-LNQVMTTDSRP--------SPQTSTSHPEMASWTSP--------------------NFS
AG-GPSQSVKPC---------------------RLRSY-VMSFDSETLQSYATIRSKEAF
GIIEKHTEALFG------K-----PEIVITPE---GTVD--SSK----------------
------------------------------------------------------------
------------------------------------------------------------
------DEHVRISFAG-LRRLIL-------------------------------------
--------------------------------------------------------EAVT
FGSFLWDVESFVDTRYHFVAN---------------------------
>gi|140069555|gb|ABO83968.1|	   421 residues, 50 /line  Protein of unknown function DUF760 [Medicago truncatula]
----------MDVAATAVLLLSPPPSSITTGSCR-----LLHF---PPSNNKVC---ASV
PIPRHK----------------------HE----------RLSVGIAANTITRRRRRRSF
-VVRAAT-SSSSSPDP---DSSHKIAPLQFQSPIGQFLS-------------------QI
LI---------NHPHLVPAAVDQQLLQLQSDRDVAHH-------------QQNQDPSPTT
STDLVLYRRIAEVKANERRTALEEILYTLVVQKFMDANISLIP---SITP----DASGR-
------------------------------------------------------------
----------------------VDSWS-NEDGKLEQLHS-NEAYEMIQNHLALILGNRA-
---GDLS-SVAQISKLRVGQVYAASVMYG-------------------------------
-------------------YFLKRVDQRFQLEKSMKVLTSASDD--SS------------
-IHQTIVDDARPG----SEVDTSQVTSHPEVSTWPGG--------------------DVS
PG-GFGYGIKPT---------------------RLRNY-VMSFDGDTLQRYATIRSKEAV
SIIEKHTEALFG------R-----PGMVITHE---GGID--YSE----------------
------------------------------------------------------------
------------------------------------------------------------
------DETIKISFGG-LRRLVL-------------------------------------
--------------------------------------------------------EAVT
FGCFLWDVESYVDSRYRFVLN---------------------------
>gi|13561930|gb|AAK30572.1|AF346660_1	   256 residues, 50 /line  unknown [Brassica napus]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------TLEEILYALVVQKFMEANVSLVP---SITPSS-SDPSGR-
------------------------------------------------------------
----------------------VDTWP-TKVEKLEKLHS-SEMYEMIHNHLALILGPRM-
---GDLA-SVAQISKLRVGQVYAASVMYG-------------------------------
-------------------YFLKRVDQRFQLEKSMKLLTGGLDESKTS------------
-VEQPE----------NV-TF-KAVSSHPEVGSFAGG---------------------VS
AK-GFGSEIKPS---------------------RLRTY-VMSFDSETLQRYATIRSREAV
GIIEKHTEALFG------K-----PEIVITPE---GTVD--SSK----------------
------------------------------------------------------------
------------------------------------------------------------
------DEQIKISFGG-MKRLVL-------------------------------------
--------------------------------------------------------EAVT
FGSFLWDVESHVDARYHFVLN---------------------------
>gi|145332615|ref|NP_001078173.1|	   427 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------MDALTSSLVRSPIVPSRTSDNGSG-----SMFL---TASGPGFTRSGSSR
LQLRLR--------------VCPKSLQNAS----------ARSSRSLQSLTTTAKTRRSF
-VVRASSASNDA-SSG---SSPKPIAPLQLQSPAGQFLS-------------------QI
LV---------SHPHLVPAAVEQQLEQLQTDRDSQG---------------QNKDSASVP
GTDIVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLVP---SVSPSS--DPSGR-
------------------------------------------------------------
----------------------VDTWP-TKVEKLERLHS-PEMYEMIHNHLALILGSRM-
---GDLN-SVAQISKLRVGQVYAASVMYG-------------------------------
-------------------YFLKRVDQRFQLEKTMKILPGGSDESKTS------------
-VEQAE----------GTATYQAAVSSHPEVGAFAGG---------------------VS
AK-GFGSEIKPS---------------------RLRSY-VMSFDAETLQRYATIRSREAV
GIIEKHTEALFG------K-----PEIVITPE---GTVD--SSK----------------
------------------------------------------------------------
------------------------------------------------------------
------DEQIKISFGG-MKRLVL-------------------------------------
--------------------------------------------------------EAVT
FGSFLWDVESHVDARYHFVLN---------------------------
>gi|15221185|ref|NP_175278.1|	   423 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------MDAVAANLFQSPSLLRQTSER--------LIFS---TPNCPGFMRI-SSG
PQFRLR--------------------QNSS----------LKFSRPFQSGTTCVKSRRSF
-VVKASA-SGDA--------STESIAPLQLKSPVGQFLS-------------------QI
LV---------SHPHLVPAAVEQQLEQLQIDRDAEE---------------QSKDASSVL
GTDIVLYRRIAEVKEKERRRALEEILYALVVQKFMDANVTLVP---SITSSS-ADPSGR-
------------------------------------------------------------
----------------------VDTWP-TLDGELERLHS-PEVYEMIQNHLSIILKNRT-
---DDLT-AVAQISKLGVGQVYAASVMYG-------------------------------
-------------------YFLKRIDQRFQLEKTMRILPGGSDEGETS------------
-IEQAGRDVERNFYEEAEETY-QAVSSNQDVGSFVGG---------------------IN
ASGGFSSDMKQS---------------------RLKTY-VMSFDGETLQRYATIRSRESV
GIIEKHTEALFG------R-----PEIVITPQ---GTID--SSK----------------
------------------------------------------------------------
------------------------------------------------------------
------DEHIKISFKG-LKRLVL-------------------------------------
--------------------------------------------------------EAVT
FGSFLWDVESHVDSRYHFVLN---------------------------
>gi|79319480|ref|NP_001031154.1|	   342 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------MDAVAANLFQSPSLLRQTSER--------LIFS---TPNCPGFMRI-SSG
PQFRLR--------------------QNSS----------LKFSRPFQSGTTCVKSRRSF
-VVKASA-SGDA--------STESIAPLQLKSPVGQFLS-------------------QI
LV---------SHPHLVPAAVEQQLEQLQIDRDAEE---------------QSKDASSVL
GTDIVLYRRIAEVKEKERRRALEEILYALVVQKFMDANVTLVP---SITSSS-ADPSGR-
------------------------------------------------------------
----------------------VDTWP-TLDGELERLHS-PEVYEMIQNHLSIILKNRT-
---DDLT-AVAQISKLGVGQVYAASVMYG-------------------------------
-------------------YFLKRIDQRFQLEKTMRILPGGSDEGETS------------
-IEQAGRDVERNFYEEAEETY-QAVSSNQDVGSFVGG---------------------IN
ASGGFSSDMK--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--SIVWEARDCDNATRHY------------------------------
>gi|115460262|ref|NP_001053731.1|	   405 residues, 50 /line  Os04g0595100 [Oryza sativa (japonica cultivar-group)]
---------MAAWADAALLRASSSPASATAAASSS------------SSSCCLARP-RAS
LESRLHRR-----------------------------KSFLYTSSPKSGFLINSCRARSL
-KVKAK-----M-DSG---DGLTRLAPLMFETPSGQLLV-------------------QI
LQ---------SHPHLLPATVDQQLENLQSEKDAQEK-------------------EASK
VPQDLLYKRIAEVKEKERQNTLEEIIYCWIIYKFMENDISMTP---ALAPLG--GPVRD-
------------------------------------------------------------
----------------------ISSLP-NQEDRLQSIHS-PDALEMIQNHLNLIMGEKVA
---APLD-TVVEISNLNLGKLYAASIMYG-------------------------------
-------------------YFLKRVDERFQLEKNMKTLPPNPKQ-QIV------------
-LENL-KPN---PFWDM----ESLVQITPD---------------------------GEE
ID-LDDEESNPN------------------------------------------------
--------------------------------------------KLRSYVSRLDADTLQR
YA------------------------------TIRSKEAVSLIEKQTQALFGRPDIK---
---------VLDDGSVNAKD----------------------------------------
------GQMITITFIE-LTHLVL-------------------------------------
--------------------------------------------------------EAAA
FGSFLWEAESHVESKYHFVNS---------------------------
>gi|125549565|gb|EAY95387.1|	   434 residues, 50 /line  hypothetical protein OsI_016620 [Oryza sativa (indica cultivar-group)]
---------MAAWADAALLRASSSPGSGNADAFSS------------SSCCCLRRP-SAS
LGPATPPQVTVTNSCVALCALCCFTLKYIFSCYSNIDKSFLYTSSPKSGFLINSCRARSL
-KVKAK-----M-DSG---DGLTRLAPLMFETPSGQLLV-------------------QI
LQ---------SHPHLLPATVDQQLENLQSEKDAQEK-------------------EASK
VPQDLLYKRIAEVKEKERQNTLEEIIYCWIIYKFMENDISMTP---ALAPLG--GPVRD-
------------------------------------------------------------
----------------------ISSLP-NQEDRLQSIHS-PDALEMIQNHLNLIMGEKVA
---APLD-TVVEISNLNLGKLYAASIMYG-------------------------------
-------------------YFLKRVDERFQLEKNMKTLPPNPKQ-QIV------------
-LENL-KPN---PFWDM----ESLVQITPD---------------------------GEE
ID-LDDEESNPN------------------------------------------------
--------------------------------------------KLRSYVSRLDADTLQR
YA------------------------------TIRSKEAVSLIEKQTQALFGRPDIK---
---------VLDDGSVNAKD----------------------------------------
------GQMITITFIE-LTHLVL-------------------------------------
--------------------------------------------------------EAAA
FGSFLWEAESHVESKYHFVNS---------------------------
>gi|115485409|ref|NP_001067848.1|	   351 residues, 50 /line  Os11g0456100 [Oryza sativa (japonica cultivar-group)]
---MLNWKSKCS------------------------------------------------
--------------------------------------------------------TRSP
RTTVAG---AKP-DDS---EFESVNAPLEPQTWEGSFLC-------------------GL
LK---------NQPQVLPVAAAKQLQELSNQRKDTLI----------------RWEHSIG
SPDDCLHRRIAEMKEHECQTAIEDIMYTLIVYKFFKIEVPLVP---NLSKLI--S-NKR-
------------------------------------------------------------
----------------------LQIWP-PREAELESIHG-PEVLGLIREHLTSIIRWVHR
NGPKIN-RSTLRIKRMQFSRIYSASIMYG-------------------------------
-------------------YFLKSVTTRHRLELILAQSQEFCPPIQFL------------
--NAQFNST---QKQEQ----EESIGGSAE---------------------------ISS
SS-KPSSVVDL-------------------------------------------------
-------------------------------------------HDLKSYMMGFDPKTLEL
CA------------------------------RLRSCEASNLIEKHSWALFRESMKD---
------------------------------------------------------------
--FLEPDEAVILDPSS-LKRLLL-------------------------------------
--------------------------------------------------------EAIA
FGSFLWDVEDYVDEIYKLHDS---------------------------
>gi|125544814|gb|EAY90953.1|	   239 residues, 50 /line  hypothetical protein OsI_012186 [Oryza sativa (indica cultivar-group)]
------------MPTASCLRPPLPHSSAAASASAARGLRVPLPPPPPP----------PQ
QQLF--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------QAALRLPRRRLAGV------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------GVVAASASPFDEL
YARGRPAHGSSK------ELHDLRRKNSALQM---QQFVGEEKNDLLDYLRSLTPEKVAE
LS------------------------------ESTSPGVQEAIHSVVHGLLATLS--PKI
HSKAPPPLGNASGG-------VLNLG-GEDDDC----------------------AELVE
NASLPFQPLISVPRDY-LARLLF-------------------------------------
--------------------------------------------------------WCML
LGHYIRGLEYRLELAQLLRISTDVES-------------FPSGDDLII
>gi|125544815|gb|EAY90954.1|	   419 residues, 50 /line  hypothetical protein OsI_012187 [Oryza sativa (indica cultivar-group)]
------------MPTASCLRPPLPHSSAS--ASAARGLRVPRPFAAAA----------GA
AAAAAVPG----------------------------------------------------
------------------------------------------GAAAAAQEARRGRG----
------------------------------------------------------------
------------------------------------------------------------
--RGGVRVA-------LRRALRAGEAR-------------------------PWLLQEVL
LSICLRLRFGSK---SILWNLIQDIEP-LDLSVIQKDV-PPETVDAMKRTISGMLGLLPS
---DQFR-VVVEALWNPFFKLLVSSIMTG-------------------------------
-------------------YTLRNAEYRLSFERNLELSEEDSEGQNRDISEDNHHNINLG
SP----------------------------------------------------------
----------------VTIFRLSEE-DMLQDTEKNDEELPCETVG-EDLGNLTPQVEDYI
IQLQSQLDAMKK------ELHDLRRKNSALQM---QQFVGEEKNDLLDYLRSLTPEKVAE
LS------------------------------ESTSPGVQEAIHSVVHGLLATLS--PKI
HSKAPPPLGNASGG-------ALNLG-GEDDDC----------------------AELVE
NASLPFQPLISVPRDY-LARLLF-------------------------------------
--------------------------------------------------------WCML
LGHYIRGLEYRLELAQLLRISTDVES-------------FPSGDDLVI
>gi|125587081|gb|EAZ27745.1|	   405 residues, 50 /line  hypothetical protein OsJ_011228 [Oryza sativa (japonica cultivar-group)]
------------MPTASCLCPPLPHSSAAAFASAARGLRVPFPSPPPP----------PQ
QQLF--------------------------------------------------------
-------------------------------------------QAALRLPRRRLAG----
------------------------------------------------------------
------------------------------------------------------------
--VGVV----------------AASAS-------------------------PF--DELY
ARGRPAHGSSKK---SILWNLIQDIEP-LDLSVIQKDV-PPETVDAMKRTISGMLGLLPS
---DQFR-VVVEALWNPFFKLLVSSIMTG-------------------------------
-------------------YTLRNAEYRLSFERNLELSEEDSEGQNRDISEDNHHNINLG
SP----------------------------------------------------------
----------------VTIFRLSEE-DMLQDTEKNDEELPCETVG-EDLGNLTPQAEDYI
IQLQSRLDAMKK------ELHDLRRKNSALQM---QQFVGEEKNDLLDYLRSLTPEKVAE
LS------------------------------ESTSPGVQEAIHSVVHGLLATLS--PKI
HSKAPPPLGNASGG-------VLNLG-GEDDDC----------------------AELVE
NASLPFQPLISVPRDY-LARLLF-------------------------------------
--------------------------------------------------------WCML
LGHYIRGLEYRLELAQLLRISTDVES-------------FPSGDDLII
>gi|125544818|gb|EAY90957.1|	   419 residues, 50 /line  hypothetical protein OsI_012190 [Oryza sativa (indica cultivar-group)]
-------------MKNSCLIFVEWESNCERVVFSAVWVDLLSPVKTKP------------
----ALVD----------------------------------------------------
------------------------------------------CECELRNERY--------
------------------------------------------------------------
------------------------------------------------------------
------KYA-------NAKGWQWNVAI-------------------------P-------
---VDVLCAILK---SILWNLIQDIEP-LDLSVIQKDV-PPETVDAMKRTISGMLGLLPS
---DQFR-VVVEALWNPFFKLLVSSIMTGCFNSWPVKVLVDMLVRHEILQIQMLSIRNQK
INADTAVVQSLVKLEQIIRYTLRNAEYRLYFERNLELSEEDFEGQNRDISLDNHHNINLG
SP----------------------------------------------------------
----------------VTIFRLSEE-DLLQDSEKNDEELPCEAVG-EDLGNLTPQAEDYI
IQLQSRLDAMKKSRNISSKLHDLRRKNSTLQM---QQFVGEEKNDLLDYLRSLTPEKVAE
LS------------------------------ESTSPGVQEAIHSVVHGLLATLS--PKI
HSKASPPLGNASGG-------ALN------------------------------------
---------------------LW-------------------------------------
--------------------------------------------------------GCML
LGHYIRGLEYRLELAQLLRISTDVES-------------SPSGDDLVV
>gi|15226027|ref|NP_179097.1|	   386 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------MATTTLSSFSLSLPQLL--HKPTKPLPFLFLLPRFN----------RR
FRSLTITS----------------------------------------------------
------------------------------------------SSTTSSNNFSSNCG----
------------------------------------------------------------
------------------------------------------------------------
--DDGFSLD--------------------------------------------------D
FTLHSDSRSPKK---CVLSDLIQEIEP-LDVSLIQKDV-PVTTLDAMKRTISGMLGLLPS
---DRFQ-VHIESLWEPLSKLLVSSMMTG-------------------------------
-------------------YTLRNAEYRLFLEKNLDMSGGGLDSHASENTE---YDMEGT
FP----------------------------------------------------------
-----------------------DE-DHVSSKRDSRTQNLSETIDEEGLGRVSSEAQEYI
LRLQSQLSSVKK------ELQEMRRKNAALQM---QQFVGEEKNDLLDYLRSLQPEKVAE
LS------------------------------EPAAPEVKETIHSVVHGLLATLS--PKM
HSKFPASEVPPTET-------VK--A-KSDEDC----------------------AELVE
NTSLQFQPLISLTRDY-LARLLF-------------------------------------
--------------------------------------------------------WCML
LGHYLRGLEYRMELMEVLSLTCDA-----------------NGSENVA
>gi|6648962|gb|AAF21309.1|	   404 residues, 50 /line  seed maturation protein PM23 [Glycine max]
YCFIVAARQRHRERREGKVVLVVVLLIGMATLSSILSSSLPLFHRYPN----------P-
----NPSL----------------------------------------------------
------------------------------------------FRPSLSLSFSRTKP----
------------------------------------------------------------
------------------------------------------------------------
--RSPFLVL--------------------------------------------------A
ASSHDFASNSKK---SVLTELIQEIEP-LDVSHIQKDV-PPTTADAMKRTISGMLGLLPS
---DQFH-VVIEALWEPLSKLLISSMMTG-------------------------------
-------------------YTLRNVEYRLCLEKNLDMFEGDIEKPKAESMKVDLQGLMHD
SV----------------------------------------------------------
----------------NAIEFGKNK-NLSSKVEKLHEE-----VDIQELGEISAEAQQYI
FNLQSRLSSMKK------ELHEVKRKSAALQM---QQFVGEEKNDLLDYLRSLQPEQVAQ
LS------------------------------EFTSPELKDTILSVVHGLLATLS--PKM
HSKPSTMSENTTVG-------ATNAG-SE--DC----------------------AEVLE
NSALQFQPVISLTRDY-LARLLF-------------------------------------
--------------------------------------------------------WCML
WDTILEGLSVDWKLTDLLSLTSDAEN-------------DVSGSQPIA
>gi|145351503|ref|XP_001420115.1|	   441 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
------------MATATIGRAT-----------------------------LEATR-ARA
RATATRAR--------------------GRWDAG--R----------AARARATGRARAT
GRGDGF---GDA-ETN---PAAGLKAPSTPESPRGQQLA-------------------YI
LR---------TAPEMFDAAVDSQLDGLGEEVEREAK----------------SASEEAK
TEQLVLFKRIADVRALERRNGLEDIMYTTIIQKFLSVGVDMLP---PLDETT--MLKG--
------------------------------------------------------------
----------------------IDL-----NRLTDGVHS-KEALDMVREHLMAVLGGAGE
---NAYSSQLVRMSKLQAAQVYAASIMFG-------------------------------
-------------------YFVTRADKRFQLDRMVGTLPMDPMESAMA------------
-LERLFNSA---SAMDS----IDEADAAPQNFGG----------------------EDFD
LF-SDSAPSSGT------------------------------------------------
----------------------------------------GSQLTLKQYIQNFDQSTLAQ
TA------------------------------RIVSMEGVQVAERQTGALFGSIEDLQRE
MQDAVGMNAVTPEELMDAVNDAV-------------------------------------
--AEKKVQTLTLAYAS-QRRLVL-------------------------------------
--------------------------------------------------------EAVA
FGAFLRQSETYIDGYNPKLLTPTPRGPTGPPGASLPSGDDDDGGSPVA
>gi|147805309|emb|CAN76353.1|	   446 residues, 50 /line  hypothetical protein [Vitis vinifera]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------MKRTISGMLGLLPS
---DQFH-VVIEALWLPLSKLLVSSMMTG-------------------------------
-------------------YTLRNAEYRLCLERNLNIYEGNTEKQRPEISKSDELEILLD
S-----------------------------------------------------------
----------------ADVNKSGKH-ELSSKSEENTEN-PSEGLGIQGLGEMTAEAQQYI
LHLQTQLSSVKK------ELCEVKRKNAALQM---QQFVGEEQNDLLDYLRSLQPEKVCG
DFIDQKLYRRVWLGGGRGYKLELCCNRAGGSCRAWREEIHSDIPRGVEGDGKEFK--KLM
DSSCPKGEAGGSNGQVLDSERVLRLG-LRRYGGKILYPERWYPEIWCFKSGACAKEVWVR
IVGDVCRGFVAVDKDIALRRNMQWARILIRFNVRGLPTSLHEVVRKLVRVGGQGEGVGPS
RAVESIGMAGKCCVKGGKHLLPLRLMPNAKGMAGPAFQRLNRQACGPSSLHWSTGTRCML
LGHYLRGLEYRVELIELLSLSSDAEN-------------EASGDEQVA
>gi|15239021|ref|NP_199670.1|	   344 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------MDTSLSHHGS-----------------------------LPFPP-SRR
NFVKQNRG--------------------GDCV---------------FLPSRRKFRYDSL
VVVSAA---SS---------GQSIDAPLVPRSPQGRFLS-------------------SV
LV---------KKRQLFHFAVADLLKQLADDKEASLS----------------RMFLSYG
SDEASLHRRIAQLKESDCQIAIEDIMYMLILYKFSEIRVPLVP---KLPSCI--Y-NGR-
------------------------------------------------------------
----------------------LEISP-SKDWELESIHS-FDVLELIKEHSNAVISLRVN
SSLTDDC-ATTEIDKNRLSKVYTASVLYG-------------------------------
-------------------YFLKSASLRHQLECSLSQHHG--------------------
------------------------------------------------------------
--------SFT-------------------------------------------------
-------------------------------------------KQLRHYISEFDPKILRR
CA------------------------------KPRSHEAKSLIEKQSLALFGPE------
------------------------------------------------------------
---ESSKESIVTSFSS-LKRLLL-------------------------------------
--------------------------------------------------------EAVA
FGTFLWDTEEYVDGAFKLKENENAEE-------------ETNSS---V
>gi|18397912|ref|NP_566302.1|	   368 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------MDSCLSNQTA-----------------------------LQFLP-SRS
RRQSGDGG--------------------GGFV----------------IPAKRKIQYSSM
VVVAAA---GQS-RCE---PGSSLNAPLEPRSAQGRFLR-------------------SV
LL---------NKRQLFHYAAADELKQLADDREAALA----------------RMSLSSG
SDEASLHRRIAELKERYCKTAVQDIMYMLIFYKYSEIRVPLVP---KLSRCI--Y-NGR-
------------------------------------------------------------
----------------------LEIWP-SKDWELESIYS-CDTLEIIKEHVSAVIGLRVN
SCVTDNW-ATTQIQKLHLRKVYAASILYG-------------------------------
-------------------YFLKSASLRHQLECSLSDIHGSGYLKSPIF-----------
--------------------------------------------------------GCSF
TT-GTAQISNK-------------------------------------------------
-------------------------------------------QQLRHYISDFDPETLQR
CA------------------------------KPRTEEARNLIEKQSLALFGTE------
------------------------------------------------------------
---E-SDETIVTSFSS-LKRLVL-------------------------------------
--------------------------------------------------------EAVA
FGTFLWDTELYVDGAYKLKENGNAEE-------------QEGKKS--I
>gi|21536629|gb|AAM60961.1|	   355 residues, 50 /line  seed maturation-like protein [Arabidopsis thaliana]
------------MAAASARAF-FMLSRVTDL----SKKKLILHQPPPS----------SS
PHRLPYAP----------------------------------------------------
------------------------------------------NRAVSSSAVISCLS----
------------------------------------------------------------
-------------------------------------------------------GGGVS
SDDSYVSTR---------------------------------------------------
----RSKLDRGF---AVIANLVNRIQP-LDTSVISKGL-SDSAKDSMKQTISSMLGLLPS
---DQFS-VSVTISEQPLYRLLISSIITG-------------------------------
-------------------YTLWNAEYRVSLRRNFDIPIDPRKEEEDQSSKD---NVRFG
------------------------------------------------------------
-----------------------SE-KGMSEDLGNCVE-EFERLSPQVFGDLSPEALSYI
QLLQSELSSMKE------ELDSQKKKALRIEC---EKG---NRNDLLDYLRSLDPEMVTE
LS------------------------------QLSSPEVEEIVNQLVQNVLERLF----E
DQTTSNFMQNPGIRTTDG------------------------------------------
--GDGTGRKVDTSRDY-LAKLLF-------------------------------------
--------------------------------------------------------WCML
LGHHLRGLENRLHLSCVVGLL---------------------------
>gi|71032033|ref|XP_765658.1|	   489 residues, 50 /line  hypothetical protein TP01_0131 [Theileria parva strain Muguga]
----------------------MIFGITPK-----WRRA--------------PVI-ILL
CYIFAY--------------------------FNNLV--------------------HCI
HLIPSY---KLS-FVG---YKFINKPRIPSEIRNFEPLISLPKHTENSFSLSSSFTLNSS
FRLNSFFTDNLFNRPFSPK--NLF-KSFFSNIFPSKFFSSSNLFNKSFFTSDSAKSCKN-
KSPLANFWSSLKSYLTSKFSSVKGTK------------VSAAP---KRFTRS--EPYPRN
DLSEHHTRNDLSEHHTRNDLTEPHTRNGELSDPYPRNNDLRHLSFFEFFDNPPDKVGDYK
I---RKEFNESMTQESPYMELVRTGPS--GIIKKFLKIAPSMVKDAISLTVSTLIGSFYR
---YSAE-TTIITTTDRLAALILNLQITG-------------------------------
-------------------YIYCNAEQRYRLSTLYNLNPSTSPISSLNSQTN--------
-IGQPNVNQ---TNTNQ----PNVNQV---NIGQCE------------------------
-Q-KEDFEGLSV------------------------------------------------
------------------------------------------GDELLSYVRRLPRSYING
IF------------------------------DNMNPEILYAMRYSTENAIQLLT-----
---------VLNHNYLDV------------------------------------------
--KDHQKLIIQQTGSF-AMQLCF-------------------------------------
--------------------------------------------------------WKLA
LGYCMRHQETKIELTKSLNSH---------------------------
>gi|84999722|ref|XP_954582.1|	   422 residues, 50 /line  hypothetical protein TA19020 [Theileria annulata strain Ankara]
----------------------MIFGIKPK-----WRRA--------------PVI-IFL
CYIFVH--------------------------FNNIV--------------------YCI
HLIPSY---KLS-FVC---YKWPNRFRTPPEVGDFEPLVSLREHTDHSFELNSS------
------FTNNLFNKPFFSK--NPFNKSFFSNIFPNKSLFLNNLFNKPFFNNYSKPCNKND
ESILSNFWSSLKSYVSSKFSSVKGST------------LCGNP---KRYTK---------
------------------------------SDAYLRNNDLRHLSFFDFFDNAPNNLGDYK
I---RKEFNESMTQESPYMELVRTGPS--GIIKRFLRVAPSMVKDAISLTVSTLIGSFYR
---YSAE-TTIITTTDRLAALILNLQVTG-------------------------------
-------------------YIYCNAEQRYRLSSLCNPTGTSVPGGVMNNQLT--------
-DNQP------------------------------E------------------------
-P-RDEIEGLSV------------------------------------------------
------------------------------------------GDELLSYVRRLPRSYING
IF------------------------------DNMNPEILYAMRHSTEKAIQLLT-----
---------VLNHNYLDF------------------------------------------
--KDDQKLIIQQTGSF-AMQLCF-------------------------------------
--------------------------------------------------------WKLA
LGYCMRDQETKIELTKSLNSH---------------------------
>gi|147794013|emb|CAN68920.1|	   299 residues, 50 /line  hypothetical protein [Vitis vinifera]
-----------------------MKGIKAG------------------------------
------------------------------------------------------------
-----------------------------------QSAE-------------------IS
IH---------WMPPLM------------------------------------------L
HTRLTRVRRIAAVREKERQKVLEEILYCLIVQKFVDKNISMIP---KISATS--DPVGR-
------------------------------------------------------------
----------------------VDFWP-NQEQKLESIHS-PEAFEMIQSHLSLVLGERLV
---GPLD-TIVQISKIKLGKLYAASIMYG-------------------------------
-------------------YFLKRVDERYQLERTMKTLPEGFNENRLS------------
-FEDPGPAN---RLWDP----DSLIRIPAD------D-------------------DDDG
GM-LDSVEGGSY---------------------RLRSY-VMYLDAETLQRYATIRSKEAI
SLIEKQTQALFG------K-----PDVRVSED---GSLD--TSN----------------
------------------------------------------------------------
------------------------------------------------------------
------DEVVSITFSG-LTMLVL-------------------------------------
--------------------------------------------------------EAVA
FGSFLWDSETYVESKYHFLKS---------------------------
>gi|18398302|ref|NP_564389.1|	   406 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------------MQAIGSS-----HGRRLCFNHYLSDSFSKFLSP-SSS
PSLLPQRC--------------------HSFCIPKLG----------SSSTNENGRGRSV
-TVRAS---GDE-DSN---ENFAPLAPVELESPVGQLLE-------------------QI
LR---------THPHLLPVTVDEQLEKFAAESESRK--------------------ADSS
STQDILQKRISEVRDKERRKTLAEIIYCLVVHRFVEKGISMIP---RIKPTS--DPAGR-
------------------------------------------------------------
----------------------IDLWP-NQEEKLEVIHS-ADAFEMIQSHLSSVLGDGPA
V--GPLS-SIVQIGKIKLGKLYAASAMYG-------------------------------
-------------------YFLRRVDQRYQLERTMNTLPKRPEKTRER------------
-FEEPSPPY---PLWDP----DSLIRIQPE---EYDP-------------------DEYA
IQ-RNEDESSSY---------------------GLRSY-VTYLDSDTLQRYATIRSKEAM
TLIEKQTQALFG------R-----PDIRILED---GKLD--TSN----------------
------------------------------------------------------------
------------------------------------------------------------
------DEVLSLSVSG-LAMLVL-------------------------------------
--------------------------------------------------------EAVA
FGSFLWDSESYVESKYHFLKA---------------------------
>gi|68070179|ref|XP_677001.1|	   516 residues, 50 /line  hypothetical protein [Plasmodium berghei strain ANKA]
-------------------------ETRQK-----WKKH--------------LED-KRR
KEILKH--------------------------INNMT----------KEKSNVNGKNKKK
HIINKR---NTK-QTN---YPIENDAHIEKEKKSHQDVE-------------------EE
---------DDYYEDEEEDYYEDEEEDYYEDEEDED------------EDYEES--YEDD
EENIFNPDKPNEVHNTKDSKRREENQYCKPHEYNIHSNYTNSPINNNINNAF--MPKKKN
DFPLFFPTN---------------------------------------------------
----NKHFEKTN---NKYFDKICSIPP-NELINLFFENT-RRVKEAVKNIIFNIIGNIQK
---YALD-ISVLITYDKIYNFLLQILLTG-------------------------------
-------------------YMLKNADYRLSLNESLYDQNNQNNQKENSNFKK---YFNTI
FSDNFKKPE---ELLNS----DQLINTQSDNITNYDEEKKHENNTQNENNTIHIPVYEQN
KN-INTHENNNYLSENDNNNN-SKI-HHNTKTDIGEEF-YTKFKQVTNEDLPIINTKNYI
IFLKKKINSLEN------Q-------LKALKE---NKTF--QNDDLLSYIKSLTDIQLRS
LT------------------------------DNIGTVVLDATKKIVELVIQGMT-----
--LNV------------N------------------------------------------
--KNLPNELIYTSGSV-LTYICF-------------------------------------
--------------------------------------------------------WQLI
VGYTFREMEIRDELADYFNTH---------------------------
>gi|70953945|ref|XP_746043.1|	   423 residues, 50 /line  hypothetical protein PC000671.02.0 [Plasmodium chabaudi chabaudi]
------------------------------------------------------------
---------------------------------NSLT----------KEKANIKGKKKKK
HVINKR---NTK-QTT-----IENDADIEKEKRSHENIE-------------------EE
EEDEEEEDDDEYYKDEGDNYYEEEEDDYYDEGEEEDDEEYEYGDEEDEYEGYED--EEDD
EEDFFNPDKPNETDHVKDNKSVEGNRYYKPHQYNIHSNYSNSPINNNINNAF--MPKKKN
DFPLFFPTN---------------------------------------------------
----NKHFEKTN---NKYFDKICSIPP-NELINLFFENTPERVKEAVKNIIFNIIGNIQK
---YALD-ISVLITYDKIYNFLLQILLTG-------------------------------
-------------------YMLKNADYRLSLNESLYDQNNQNNQKEIFNFKK---YFNTI
FTDNFKQPG---EALNS----GELINTQPDTITNYDEEKKNENNIQDETTNLHMPIYDQN
---------NNYLSENDNNNNSSKI-QHNRKTDVGEEF-YTKFKQATNEDLPIINTKNYI
IFLKKKITSLEN------Q-------LKALKE---NKTF--HNDDLLSYI----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------
>gi|92883440|gb|ABE86960.1|	   356 residues, 50 /line  seed maturation-like protein, putative [Medicago truncatula]
------------MAASTISSQPFILSRITN-----NPSHPSLHHPLPSLFFLRRPP-HRR
PFLFATSC--------------------HHVDG---------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--DDVVSTR---------------------------------------------------
----KSTFNRGF---TVISKMLRRIKP-LDNSVISKGV-SEASKDSMKQTISTMLGLLPS
---DHFD-VTVSFEIQPLHRLLVSSIITG-------------------------------
-------------------YTLWNAEYRMSLTRNLEMSHADQGADCETPLE----SLELK
GGE---------------------------------------------------------
-----------------EEHGETEK-VVSDLGLANSEI-CSSSTGAGVFGDLPPQALKYI
QQLQSELTNMKE------ELNAQKQEMMQLEH---DRGI---RNNLLEYLRSFDPDMVTE
MS------------------------------RPSSEEVEDIIHQLVQNILRRFL----V
DEASSNFMEQSVEGNIDD------------------------------------------
--GDEFSDKIATSRDY-LAKLLF-------------------------------------
--------------------------------------------------------WCML
LGHHLRGLENRLHLSCVVGLL---------------------------
>gi|125541753|gb|EAY88148.1|	   327 residues, 50 /line  hypothetical protein OsI_009381 [Oryza sativa (indica cultivar-group)]
--------------------MSPSLLLTS------RGTHSPAPRPQTRRASQ--------
--------L-----LVSFPS----------------------------------------
------------------------------------------RRSRFV------------
---------------------GLRLARAAADSQGPN---------------GAAPGSGSG
GDGEGKAANGAD------------------------------------------------
------------------------------------------------------------
----TKLPKNRR---DILLEYVKNVQP-EFMELFIKRA-PPQVVDAMRQTVTNMIGTLPP
---QFFA-VTVTTVAENLAQLMYSVLMTG-------------------------------
-------------------YMFRNAQYRLELQQSLEQIALPEPKEEN-DSADYAP-----
------------------------------------------------------------
----------------GTQKKVTGE-VIRWN---------------KTTGPEKIDAVKYI
ELLEAEIDELSH------------------QV---ARKSSQGSNELLEYLKTLEPQNLKE
LA------------------------------SSAGEDVVFAMNAFIKRLLAVSD--PA-
--------------------------------------------------------QMKN
H-----------------AYLHF-------------------------------------
--------------------------------------------------------VELC
HSFSMRNIEVRFDMERVLGAAPKIGE-------------LPPGEN--I
>gi|125584283|gb|EAZ25214.1|	   193 residues, 50 /line  hypothetical protein OsJ_008697 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
--------M-----QEFIRS----------------------------------------
------------------------------------------RTIMLV------------
---------------------G--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----LDSPKNRR---DILLEYVKNVQP-EFMELFIKRA-PPQVVDAMRQTVTNMIGTLPP
---QFFA-VTVTTVAENLAQLMYSVLMTG-------------------------------
-------------------YMFRNAQYRLELQQSLEQIALPEPKEE--------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------NE
LA------------------------------SSAGEDVVFAMNAFIKRLLAVSD--PA-
--------------------------------------------------------QMKN
H-----------------AYLHF-------------------------------------
--------------------------------------------------------VELC
HSFSMRNIEVRFDMERVLGAAPKIGE-------------LPPGEN--I
>gi|42562912|ref|NP_176549.3|	   340 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------MCSLSMQFSLLQ------SPPSRPCPSFLANHEPK--------
--------LSTTSSSVTFPL----------------------------------------
------------------------------------------KTNTWKCSGTG-------
---------------------NLLVLRVKAY--------------------------GSS
SDSSADSSTPPN------------------------------------------------
------------------------------------------------------------
---GTRQPKSRR---DILLEYVQNVKP-EFMEMFVKRA-PKHVVEAMRQTVTNMIGTLPP
---QFFA-VTVTSVAENLAQLMMSVLMTG-------------------------------
-------------------YMFRNAQYRLELQQSLEQVALPEPRDQKGGDEDYAP-----
------------------------------------------------------------
----------------GTQKNVSGE-VIRWN---------------NVSGPEKIDAKKYI
ELLEAEIEELNR------------------QV---GRKSANQQNEILEYLKSLEPQNLKE
LT------------------------------STAGEDVAVAMNTFVKRLLAVSD--PN-
--------------------------------------------------------QMKT
N-------VTETSAAD-LAKLLY-------------------------------------
--------------------------------------------------------WLMV
VGYSIRNIEVRFDMERVLGTQPKLAE-------------LPPGEI--I
>gi|6633836|gb|AAF19695.1|AC008047_2	   222 residues, 50 /line  F2K11.3 [Arabidopsis thaliana]
-----------------MCSLSMQFSLLQ------SPPSRPCPSFLANHEPK--------
--------LSTTSSSVTFPL----------------------------------------
------------------------------------------KTNTWKCSGTG-------
---------------------NLLVLRVKAY--------------------------GSS
SDSSADSSTPPN------------------------------------------------
------------------------------------------------------------
---G-TRPKSRR---DILLEYVQNVKP-EFMEMFVKRA-PKHVVEAMRQTVTNMIGTLPP
---QFFA-VTVTSVAENLAQLMMSVLMTG-------------------------------
-------------------YMFRNAQYRLELQQSLEQVALPEPRGI--------------
------------------------------------------------------------
------------------------------------------------------TYLALR
KLMQKSISSFWK------------------Q-------------------------RSKN
ST------------------------------VKWGE-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------NQRISR-------------MKSWSI---

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.