Fandom

Proteins Wiki

At2g14910.1/PDB

< At2g14910.1

47,923pages on
this wiki
Add New Page
Talk0 Share
&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g14910-1-1b68_A.pir.txt

======================================================

Assigned types to 386 residues in Sequence 2-14910-1, 5 remain unknown
Assigned types to 175 residues in Sequence 1b68_A, 216 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 243  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 244  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 245  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 246  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 247  All residues are positively and negatively charged

Translated sequence file At2g14910-1-1b68_A.pir.txt into sequence alignment.

======================================================

>1B68.pdb  Made from 1172 ATOM records in 1B68.pdb
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELK
AYKSELEEQLTAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQA
MLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY

======================================================

Best alignment:
1B68.pdb     18  VQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEE    58
                  Q LSE + EE L  +V+ E +  +     +L + K EL+E
2-14910-1   199  TQNLSETIDEEGL-GRVSSEAQEYILRLQSQLSSVKKELQE   238

======================================================

Highlighted IDENTICAL residue GLN   41  index1   19  path  200  %Seq 100.00
Highlighted IDENTICAL residue GLU   45  index1   23  path  204  %Seq 100.00
Highlighted IDENTICAL residue ALA   62  index1   40  path  220  %Seq 100.00
Highlighted IDENTICAL residue THR   67  index1   45  path  225  %Seq 100.00
Highlighted IDENTICAL residue LYS   72  index1   50  path  230  %Seq 100.00
Highlighted IDENTICAL residue LEU   78  index1   56  path  236  %Seq 100.00
Highlighted 6 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g14910-1-1b68_A.pir.txt.1B68.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g14910-1-1b68_A.pir.txt PIR amino_acid 1B68.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.