FANDOM


>gi|15226027|ref|NP_179097.1|	   386 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---MATTTLSSFSLSLPQ----------L--LHKPTKPLPFL-FLLPRFN---------R
RFRSL-----------------TITS----------------------------------
------------------------------SSTTSSNNFSSNCG----------------
--------------------------------DDGFSLD---------------------
--------------------------------------------------DFTLHSD---
---------------------------------------------------SRSPKK---
CVLSDLIQEIEP-LDVSLIQKDV-PVTTLDAMKRTISGMLGLLPS---DRFQ-VHIESLW
EPLSKLLVSSMMTG----------------------------------------------
----YTLRNAEYRLFLEKNLDMSGGGLDSHASENTE---YDMEGTFP-------------
------------------------------------------------------------
-------DE-DHVSSKRDSRTQNLSETIDEEGLGRVSSEAQEYILRLQSQLSSVKK----
--ELQEMRRKNAALQMQQFVGEEKNDLLDYLRSLQPEKVAELS-----------------
-------------EPAAPEVKETIHSVVHGLLATLSPKMHSKFPASEV--PPTE---T--
-----VK--A-------------------------KSDEDCAELVENTSLQFQPLISLTR
DY-LARLLF---------------------------------------------------
------------------------------------------WCMLLGHYLRGLEYRMEL
MEVLSLTCDA-----------------NGSENVA
>gi|108862884|gb|ABA99135.2|	   420 residues, 50 /line  seed maturation protein PM23, putative, expressed [Oryza sativa (japonica cultivar-group)]
---MPISSGILAPTRGAS----------SSSSAVGRKLLLLG-ARHPP------------
-SSVAVAGRGVWRRGL--------------------------------------------
-----------------------AGVGVAAAAASSSSPDELHAR----------------
--------------------------------GRPLRGGAYE-----------------E
VSERAQPRGLNSMFLLHVIR----------------------------------------
-------------------------------------------------NRRIEAKR---
SALWNLIKDIEP-LDLSIIQKDV-PSETVDAMKRTVSGMLGLLPS---DQFH-VVIESLW
NPFFKLLASSIMTG----------------------------------------------
----YTLFNAQYRLSLERTLEFSEEETECKKRDSCEEIH---SVGRP-------------
------------------------------------------------------------
SMFLSLPEDVGLTIESEMADEKL-CGNM--DGLGSLSIEAKKLILGMQSRLDSMEK----
--ELHELKKKNSSQQMQQFAGEEKNELLYYLRSLSPEKVVELS-----------------
-------------ESSCPGVEEAVYSVVHGLLATLSPKMHTNRSPTSE--NMAG---G--
-----AVNFG------------------------MEEDDEFTELVEDVSLPFQPLISIPR
DR-LARLLF---------------------------------------------------
------------------------------------------WCMMLGHYIRGQECRLEL
MHLLAVSSDAHS----------------------
>gi|110224762|emb|CAL07981.1|	   273 residues, 50 /line  hypothetical protein [Platanus x acerifolia]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------RRIAE
VKANERRKALEEILYALVVQKFMDADVSLMP---TISPSSATDASTQ-------------
------------------------------------------------------------
-------VGTWP-GQEEKLKQLHS-PEAYEMIQNHLALILGNRV----ANSN-TVAQISK
LRVGQVYAASVMYG----------------------------------------------
----YFLKRVDQRFQLEKTMKILPFASDEEKSD-------------IEQSVAEEMRPGG-
-GKASAYAEQTHPEVSSQPGN---------------------FSPG-GFGHGIK------
---------------PSRLRTY-VMAFDAETLQSYATIRSKEAVTIIEK-----------
------------------------------------------------------------
--------------------------HTEALFGRPE------------IVITPQ---GTI
DSS------------------------------------------------KDELVRISF
GG-LKRLVL---------------------------------------------------
------------------------------------------EAVTFGSFLWDVESYVDS
R---------------------------------
>gi|147854215|emb|CAN79123.1|	   411 residues, 50 /line  hypothetical protein [Vitis vinifera]
-MEAAIATVVPSSLGFSRATNF---R--SRSTVFNVNGYLNL-KSHSRPGHR--------
------------------------KMAS--------------GWKEQT-MVRAX-ATVD-
NDSY---ESAAXIAPLRLESPIGRFLT-------------------EILI---------S
HPHLVPAAVERQLEQFQTDRDAEGH----------------KQESSASGIELLLYRRIAK
VKANERKKALEEILYVLVVQKFVGANVPLIP---RMSPSS-LGSSGR-------------
------------------------------------------------------------
-------VDNWP-SLDRDLGELHS-PEATEMIQNHLAFILGNRF----GDST-SVAKMSK
LRVGQVYAASVMYG----------------------------------------------
----YFLKRVDERFQLEKTMKILPYALDGDKGY-------------VEEAMGMS--PFG-
-SDDSVQGVESQPEASCWAGG---------------------LTIG-SFGHWKK------
---------------PSSLGSY-VKLIDAETLMRYTTIRSMEAVSIIQK-----------
------------------------------------------------------------
--------------------------HTQALFGRRD------------VAIIPNIPMWTL
DSS------------------------------------------------EDELIKMSF
GG-LKRLVL---------------------------------------------------
------------------------------------------EALTFGSFLWDVESFVDS
RLHFVVN---------------------------
>gi|125545521|gb|EAY91660.1|	   413 residues, 50 /line  hypothetical protein OsI_012893 [Oryza sativa (indica cultivar-group)]
-MEAAAAAAAALLSPPAAAAPS---R-------RPGTPGA---TSLPFARRR--------
--------------------------GVAAVKGLGRQQLT--CRRRGV-VVRAAS-WSPS
GPESLPPPPSSSIAPLQMESPVGQFLS-------------------QILA---------T
HPHLLPAAAEQQLEQLQTDRDAAKDNGG-------------DKP-APSDGDIVLYRRIAE
VKEKERKRALEEILYALVVQKFVEAGVSLVP---ALSHSI--SSSGR-------------
------------------------------------------------------------
-------VDQWAESVEGKLEKMHS-QEAYEMIENHLALILGQRQ----AD-A-TVAAISK
LRVGQVYAASVMYG----------------------------------------------
----YFLKRVDQRFQLEKSMKTLPWGSEEE-DK-------------LNQVMTTDSRP---
----SPQTSTSHPEMASWTSP--------------------NFSAG-GPSQSVK------
---------------PCRLRSY-VMSFDSETLQSYATIRSKEAFGIIEK-----------
------------------------------------------------------------
--------------------------HTEALFGKPE------------IVITPE---GTV
DSS------------------------------------------------KDEHVRISF
AG-LRRLIL---------------------------------------------------
------------------------------------------EAVTFGSFLWDVESFVDT
RYHFVAN---------------------------
>gi|140069555|gb|ABO83968.1|	   421 residues, 50 /line  Protein of unknown function DUF760 [Medicago truncatula]
-MDVAATAVLLLSPPPSSITTG---SCRLLHFPPSNNKVC---ASVPIPRHK--------
--------------------------HERLSVGIAANTITRRRRRRSF-VVRAAT-SSSS
SPDP---DSSHKIAPLQFQSPIGQFLS-------------------QILI---------N
HPHLVPAAVDQQLLQLQSDRDVAHHQQN-------------QDPSPTTSTDLVLYRRIAE
VKANERRTALEEILYTLVVQKFMDANISLIP---SITP----DASGR-------------
------------------------------------------------------------
-------VDSWS-NEDGKLEQLHS-NEAYEMIQNHLALILGNRA----GDLS-SVAQISK
LRVGQVYAASVMYG----------------------------------------------
----YFLKRVDQRFQLEKSMKVLTSASDD--SS-------------IHQTIVDDARPG--
-SEVDTSQVTSHPEVSTWPGG--------------------DVSPG-GFGYGIK------
---------------PTRLRNY-VMSFDGDTLQRYATIRSKEAVSIIEK-----------
------------------------------------------------------------
--------------------------HTEALFGRPG------------MVITHE---GGI
DYS------------------------------------------------EDETIKISF
GG-LRRLVL---------------------------------------------------
------------------------------------------EAVTFGCFLWDVESYVDS
RYRFVLN---------------------------
>gi|13561930|gb|AAK30572.1|AF346660_1	   256 residues, 50 /line  unknown [Brassica napus]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------TLEEILYALVVQKFMEANVSLVP---SITPSS-SDPSGR-------------
------------------------------------------------------------
-------VDTWP-TKVEKLEKLHS-SEMYEMIHNHLALILGPRM----GDLA-SVAQISK
LRVGQVYAASVMYG----------------------------------------------
----YFLKRVDQRFQLEKSMKLLTGGLDESKTS-------------VEQPENV-------
----TFKAVSSHPEVGSFAGG---------------------VSAK-GFGSEIK------
---------------PSRLRTY-VMSFDSETLQRYATIRSREAVGIIEK-----------
------------------------------------------------------------
--------------------------HTEALFGKPE------------IVITPE---GTV
DSS------------------------------------------------KDEQIKISF
GG-MKRLVL---------------------------------------------------
------------------------------------------EAVTFGSFLWDVESHVDA
RYHFVLN---------------------------
>gi|145332615|ref|NP_001078173.1|	   427 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-MDALTSSLVRSPIVPSRTSDN---GSGSMFLTASGPGFTRSGSSRLQLRLRV-------
-------------------CPKSLQNASARSSRSLQSLTTTAKTRRSF-VVRASSASNDA
-SSG---SSPKPIAPLQLQSPAGQFLS-------------------QILV---------S
HPHLVPAAVEQQLEQLQTDRDSQG--QN-------------KDSASVPGTDIVLYRRIAE
LKENERRRTLEEILYALVVQKFMEANVSLVP---SVSPSS--DPSGR-------------
------------------------------------------------------------
-------VDTWP-TKVEKLERLHS-PEMYEMIHNHLALILGSRM----GDLN-SVAQISK
LRVGQVYAASVMYG----------------------------------------------
----YFLKRVDQRFQLEKTMKILPGGSDESKTS-------------VEQAEGTAT-----
----YQAAVSSHPEVGAFAGG---------------------VSAK-GFGSEIK------
---------------PSRLRSY-VMSFDAETLQRYATIRSREAVGIIEK-----------
------------------------------------------------------------
--------------------------HTEALFGKPE------------IVITPE---GTV
DSS------------------------------------------------KDEQIKISF
GG-MKRLVL---------------------------------------------------
------------------------------------------EAVTFGSFLWDVESHVDA
RYHFVLN---------------------------
>gi|15221185|ref|NP_175278.1|	   423 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-MDAVAANLFQSPSLLRQTSER------LIFSTPNCPGFMRI-SSGPQFRLR--------
------------------------QNSSLKFSRPFQSGTTCVKSRRSF-VVKASA-SGDA
--------STESIAPLQLKSPVGQFLS-------------------QILV---------S
HPHLVPAAVEQQLEQLQIDRDAEE--QS-------------KDASSVLGTDIVLYRRIAE
VKEKERRRALEEILYALVVQKFMDANVTLVP---SITSSS-ADPSGR-------------
------------------------------------------------------------
-------VDTWP-TLDGELERLHS-PEVYEMIQNHLSIILKNRT----DDLT-AVAQISK
LGVGQVYAASVMYG----------------------------------------------
----YFLKRIDQRFQLEKTMRILPGGSDEGETS-------------IEQAGRDVERNFYE
EAEETYQAVSSNQDVGSFVGG---------------------INASGGFSSDMK------
---------------QSRLKTY-VMSFDGETLQRYATIRSRESVGIIEK-----------
------------------------------------------------------------
--------------------------HTEALFGRPE------------IVITPQ---GTI
DSS------------------------------------------------KDEHIKISF
KG-LKRLVL---------------------------------------------------
------------------------------------------EAVTFGSFLWDVESHVDS
RYHFVLN---------------------------
>gi|79319480|ref|NP_001031154.1|	   342 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-MDAVAANLFQSPSLLRQTSER------LIFSTPNCPGFMRI-SSGPQFRLR--------
------------------------QNSSLKFSRPFQSGTTCVKSRRSF-VVKASA-SGDA
--------STESIAPLQLKSPVGQFLS-------------------QILV---------S
HPHLVPAAVEQQLEQLQIDRDAEE--QS-------------KDASSVLGTDIVLYRRIAE
VKEKERRRALEEILYALVVQKFMDANVTLVP---SITSSS-ADPSGR-------------
------------------------------------------------------------
-------VDTWP-TLDGELERLHS-PEVYEMIQNHLSIILKNRT----DDLT-AVAQISK
LGVGQVYAASVMYG----------------------------------------------
----YFLKRIDQRFQLEKTMRILPGGSDEGETS-------------IEQAGRDVERNFYE
EAEETYQAVSSNQDVGSFVGG---------------------INASGGFSSDMK------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------SIVWEARDCDNA
TRHY------------------------------
>gi|115460262|ref|NP_001053731.1|	   405 residues, 50 /line  Os04g0595100 [Oryza sativa (japonica cultivar-group)]
MAAWADAALLRASSSPAS-------ATAAASSSSSSCCLARP-RASLESRLHRR------
-------------------------KSFLYTSSPKSGFLINSCRARSL-KVKAK-----M
-DSG---DGLTRLAPLMFETPSGQLLV-------------------QILQ---------S
HPHLLPATVDQQLENLQSEKDAQEK-------------------EASKVPQDLLYKRIAE
VKEKERQNTLEEIIYCWIIYKFMENDISMTP---ALAPLG--GPVRD-------------
------------------------------------------------------------
-------ISSLP-NQEDRLQSIHS-PDALEMIQNHLNLIMGEKVA---APLD-TVVEISN
LNLGKLYAASIMYG----------------------------------------------
----YFLKRVDERFQLEKNMKTLPPNPKQ-QIV-------------LENL-KPN---PFW
DME---SLVQITP---------------------------DGEEID-LDDEESN------
------------------------------------------------------------
-----------------------PNKLRSYVSRLDADTLQRYA-----------------
-------------TIRSKEAVSLIEKQTQALFGRPD------------IKVLDD---GSV
NAK------------------------------------------------DGQMITITF
IE-LTHLVL---------------------------------------------------
------------------------------------------EAAAFGSFLWEAESHVES
KYHFVNS---------------------------
>gi|125549565|gb|EAY95387.1|	   434 residues, 50 /line  hypothetical protein OsI_016620 [Oryza sativa (indica cultivar-group)]
MAAWADAALLRASSSPGS-------GNADAFSSSSCCCLRRP-SASLGPATPPQVTVTNS
CVALCALCC--FTLKYIFSCYSNIDKSFLYTSSPKSGFLINSCRARSL-KVKAK-----M
-DSG---DGLTRLAPLMFETPSGQLLV-------------------QILQ---------S
HPHLLPATVDQQLENLQSEKDAQEK-------------------EASKVPQDLLYKRIAE
VKEKERQNTLEEIIYCWIIYKFMENDISMTP---ALAPLG--GPVRD-------------
------------------------------------------------------------
-------ISSLP-NQEDRLQSIHS-PDALEMIQNHLNLIMGEKVA---APLD-TVVEISN
LNLGKLYAASIMYG----------------------------------------------
----YFLKRVDERFQLEKNMKTLPPNPKQ-QIV-------------LENL-KPN---PFW
DME---SLVQITP---------------------------DGEEID-LDDEESN------
------------------------------------------------------------
-----------------------PNKLRSYVSRLDADTLQRYA-----------------
-------------TIRSKEAVSLIEKQTQALFGRPD------------IKVLDD---GSV
NAK------------------------------------------------DGQMITITF
IE-LTHLVL---------------------------------------------------
------------------------------------------EAAAFGSFLWEAESHVES
KYHFVNS---------------------------
>gi|115485409|ref|NP_001067848.1|	   351 residues, 50 /line  Os11g0456100 [Oryza sativa (japonica cultivar-group)]
----MLNWKSKCSTRSPRTT----------------------------------------
-------------------------------------------------VAGAK---PD-
--DS---EFESVNAPLEPQTWEGSFLC-------------------GLLK---------N
QPQVLPVAAAKQLQELSNQRKDTLI----------------RWEHSIGSPDDCLHRRIAE
MKEHECQTAIEDIMYTLIVYKFFKIEVPLVP---NLSKLI--S-NKR-------------
------------------------------------------------------------
-------LQIWP-PREAELESIHG-PEVLGLIREHLTSIIRWVHRNGPKIN-RSTLRIKR
MQFSRIYSASIMYG----------------------------------------------
----YFLKSVTTRHRLELILAQSQEFCPPIQFL--------------NAQFNST---QKQ
EQE---ESIGGSA---------------------------EISSSS-KPSSVVD------
------------------------------------------------------------
-----------------------LHDLKSYMMGFDPKTLELCA-----------------
-------------RLRSCEASNLIEKHSWALFRESM-----------------------K
DFLE-----------------------------------------------PDEAVILDP
SS-LKRLLL---------------------------------------------------
------------------------------------------EAIAFGSFLWDVEDYVDE
IYKLHDS---------------------------
>gi|125544814|gb|EAY90953.1|	   239 residues, 50 /line  hypothetical protein OsI_012186 [Oryza sativa (indica cultivar-group)]
---MPTASCLRPPLPHSS----------AAASASAARGLRVP-LPPPPPP---------P
QQQLF-------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------QAALRLPRRRLAGV---------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------GVVAASASPFDELYARGRPAHGSSK----
--ELHDLRRKNSALQMQQFVGEEKNDLLDYLRSLTPEKVAELS-----------------
-------------ESTSPGVQEAIHSVVHGLLATLSPKIHSKAPPPLG--NASG---G--
-----VLNLG-------------------------GEDDDCAELVENASLPFQPLISVPR
DY-LARLLF---------------------------------------------------
------------------------------------------WCMLLGHYIRGLEYRLEL
AQLLRISTDVES-------------FPSGDDLII
>gi|125544815|gb|EAY90954.1|	   419 residues, 50 /line  hypothetical protein OsI_012187 [Oryza sativa (indica cultivar-group)]
---MPTASCLRPPLPHSS------------ASASAARGLRVP-RPFAAAA---------G
AAAAA-----------------AVPG----------------------------------
------------------------------GAAAAAQEARRGRG----------------
--------------------------------RGGVRVA----------------LRRAL
RAGEARPWLLQEV-------------------------------------LLSICLR---
---------------------------------------------------LRFGSK---
SILWNLIQDIEP-LDLSVIQKDV-PPETVDAMKRTISGMLGLLPS---DQFR-VVVEALW
NPFFKLLVSSIMTG----------------------------------------------
----YTLRNAEYRLSFERNLELSEEDSEGQNRDISEDNHHNINLGSP-------------
------------------------------------------------------------
VTIFRLSEE-DMLQDTEKNDEELPCETVG-EDLGNLTPQVEDYIIQLQSQLDAMKK----
--ELHDLRRKNSALQMQQFVGEEKNDLLDYLRSLTPEKVAELS-----------------
-------------ESTSPGVQEAIHSVVHGLLATLSPKIHSKAPPPLG--NASG---G--
-----ALNLG-------------------------GEDDDCAELVENASLPFQPLISVPR
DY-LARLLF---------------------------------------------------
------------------------------------------WCMLLGHYIRGLEYRLEL
AQLLRISTDVES-------------FPSGDDLVI
>gi|40538958|gb|AAR87215.1|	   405 residues, 50 /line  expressed protein [Oryza sativa (japonica cultivar-group)]
---MPTASCLRPPLPHSS----------AAASASAARGLRVP-LPPPPPP---------P
QQQLF-------------------------------------------------------
-------------------------------QAALRLPRRRLAG----------------
--------------------------------VGVV------------------------
-AASASPF--DEL-------------------------------------YARGRPA---
---------------------------------------------------HGSSKK---
SILWNLIQDIEP-LDLSVIQKDV-PPETVDAMKRTISGMLGLLPS---DQFR-VVVEALW
NPFFKLLVSSIMTG----------------------------------------------
----YTLRNAEYRLSFERNLELSEEDSEGQNRDISEDNHHNINLGSP-------------
------------------------------------------------------------
VTIFRLSEE-DMLQDTEKNDEELPCETVG-EDLGNLTPQAEDYIIQLQSRLDAMKK----
--ELHDLRRKNSALQMQQFVGEEKNDLLDYLRSLTPEKVAELS-----------------
-------------ESTSPGVQEAIHSVVHGLLATLSPKIHSKAPPPLG--NASG---G--
-----VLNLG-------------------------GEDDDCAELVENASLPFQPLISVPR
DY-LARLLF---------------------------------------------------
------------------------------------------WCMLLGHYIRGLEYRLEL
AQLLRISTDVES-------------FPSGDDLII
>gi|125544818|gb|EAY90957.1|	   419 residues, 50 /line  hypothetical protein OsI_012190 [Oryza sativa (indica cultivar-group)]
----MKNSCLIFVEWESN----------CERVVFSAVWVDL--LSPVKTK---------P
----------------------ALVD----------------------------------
------------------------------CECELRNER---------------------
-----------------------------------YKYA----------------NAKGW
QWNVAIP-----------------------------------------------VDV---
---------------------------------------------------LCAILK---
SILWNLIQDIEP-LDLSVIQKDV-PPETVDAMKRTISGMLGLLPS---DQFR-VVVEALW
NPFFKLLVSSIMTGCFNSWPVKVLVDMLVRHEILQIQMLSIRNQKINADTAVVQSLVKLE
QIIRYTLRNAEYRLYFERNLELSEEDFEGQNRDISLDNHHNINLGSP-------------
------------------------------------------------------------
VTIFRLSEE-DLLQDSEKNDEELPCEAVG-EDLGNLTPQAEDYIIQLQSRLDAMKKSRNI
SSKLHDLRRKNSTLQMQQFVGEEKNDLLDYLRSLTPEKVAELS-----------------
-------------ESTSPGVQEAIHSVVHGLLATLSPKIHSKASPPLG--NASG---G--
-----ALN----------------------------------------------------
-------LW---------------------------------------------------
------------------------------------------GCMLLGHYIRGLEYRLEL
AQLLRISTDVES-------------SPSGDDLVV
>gi|42570781|ref|NP_973464.1|	   366 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---MATTTLSSFSLSLPQ----------L--LHKPTKPLPFL-FLLPRFN---------R
RFRSL-----------------TITS----------------------------------
------------------------------SSTTSSNNFSSNCG----------------
--------------------------------DDGFSLD---------------------
--------------------------------------------------DFTLHSD---
---------------------------------------------------SRSPKK---
CVLSDLIQEIEP-LDVSLIQKDV-PVTTLDAMKRTISGMLGLLPS---DRFQ-VHIESLW
EPLSKLLVSSMMTG----------------------------------------------
----YTLRNAEYRLFLEKNLDMSGGGLDSHASENTE---YDMEGTFP-------------
------------------------------------------------------------
-------DE-DHVSSKRDSRTQNLSETIDEEGLGRVSSEAQEYILRLQSQLSSVKK----
--ELQEMRRKNAALQMQQFVGEEKNDLLDYLRSLQPEKVAELS-----------------
-------------EPAAPEVKETIHSVVHGLLATLSPKMHSKFPASEV--PPTE---T--
-----VK--A-------------------------KSDEDCAELVENTSLQFQPLISLTR
DY-LARLLF---------------------------------------------------
------------------------------------------WLEELPS-----------
STSLSLA--------------------------C
>gi|6648962|gb|AAF21309.1|	   404 residues, 50 /line  seed maturation protein PM23 [Glycine max]
-YCFIVAARQRHRERREGKVVLVVVLLIGMATLSSILSSSLP-LFHRYPN---------P
----------------------NPSL----------------------------------
------------------------------FRPSLSLSFSRTKP----------------
--------------------------------RSPFLVL---------------------
--------------------------------------------------AASSHDF---
---------------------------------------------------ASNSKK---
SVLTELIQEIEP-LDVSHIQKDV-PPTTADAMKRTISGMLGLLPS---DQFH-VVIEALW
EPLSKLLISSMMTG----------------------------------------------
----YTLRNVEYRLCLEKNLDMFEGDIEKPKAESMKVDLQGLMHDSV-------------
------------------------------------------------------------
NAIEFGKNK-NLSSKVEKLHEE-----VDIQELGEISAEAQQYIFNLQSRLSSMKK----
--ELHEVKRKSAALQMQQFVGEEKNDLLDYLRSLQPEQVAQLS-----------------
-------------EFTSPELKDTILSVVHGLLATLSPKMHSKPSTMSE--NTTV---G--
-----ATNAG-------------------------SE--DCAEVLENSALQFQPVISLTR
DY-LARLLF---------------------------------------------------
------------------------------------------WCMLWDTILEGLSVDWKL
TDLLSLTSDAEN-------------DVSGSQPIA
>gi|145351503|ref|XP_001420115.1|	   441 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
---MATATIGRAT----------------------------------------LEATRAR
ARATA-----------------TRARGRWDA--GRAARARATGRARATGRGDGF---GDA
-ETN---PAAGLKAPSTPESPRGQQLA-------------------YILR---------T
APEMFDAAVDSQLDGLGEEVEREAK----------------SASEEAKTEQLVLFKRIAD
VRALERRNGLEDIMYTTIIQKFLSVGVDMLP---PLDETT--MLKG--------------
------------------------------------------------------------
-------IDL-----NRLTDGVHS-KEALDMVREHLMAVLGGAGE---NAYSSQLVRMSK
LQAAQVYAASIMFG----------------------------------------------
----YFVTRADKRFQLDRMVGTLPMDPMESAMA-------------LERLFNSA---SAM
DSI---DEADAAPQNFGG----------------------EDFDLF-SDSAPSSGT----
------------------------------------------------------------
---------------------GSQLTLKQYIQNFDQSTLAQTA-----------------
-------------RIVSMEGVQVAERQTGALFGSIEDLQREMQDAVGMNAVTPE---ELM
DAVNDAV--------------------------------------AEK---KVQTLTLAY
AS-QRRLVL---------------------------------------------------
------------------------------------------EAVAFGAFLRQSETYIDG
YNPKLLTPTPRGPTGPPGASLPSGDDDDGGSPVA
>gi|147805309|emb|CAN76353.1|	   446 residues, 50 /line  hypothetical protein [Vitis vinifera]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------MKRTISGMLGLLPS---DQFH-VVIEALW
LPLSKLLVSSMMTG----------------------------------------------
----YTLRNAEYRLCLERNLNIYEGNTEKQRPEISKSDELEILLDS--------------
------------------------------------------------------------
ADVNKSGKH-ELSSKSEENTEN-PSEGLGIQGLGEMTAEAQQYILHLQTQLSSVKK----
--ELCEVKRKNAALQMQQFVGEEQNDLLDYLRSLQPEKVCGDFIDQKLYRRVWLGGGRGY
KLELCCNRAGGSCRAWREEIHSDIPRGVEGDGKEFKKLMDSSCPKGEA--GGSN---GQV
LDSERVLRLGLRRYGGKILYPERWYPEIWCFKSGACAKEVWVRIVGDV---CRGFVAVDK
DIALRRNMQWARILIRFNVRGLPTSLHEVVRKLVRVGGQGEGVGPSRAVESIGMAGKCCV
KGGKHLLPLRLMPNAKGMAGPAFQRLNRQACGPSSLHWSTGTRCMLLGHYLRGLEYRVEL
IELLSLSSDAEN-------------EASGDEQVA
>gi|15239021|ref|NP_199670.1|	   344 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---MDTSLSHHGS----------------------------------------LPFPPSR
RNFVK-----------------QNRGGDCV-----FLPSRRKFRYDSLVVVSAA---SS-
--------GQSIDAPLVPRSPQGRFLS-------------------SVLV---------K
KRQLFHFAVADLLKQLADDKEASLS----------------RMFLSYGSDEASLHRRIAQ
LKESDCQIAIEDIMYMLILYKFSEIRVPLVP---KLPSCI--Y-NGR-------------
------------------------------------------------------------
-------LEISP-SKDWELESIHS-FDVLELIKEHSNAVISLRVNSSLTDDC-ATTEIDK
NRLSKVYTASVLYG----------------------------------------------
----YFLKSASLRHQLECSLSQHHG-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------SFTKQLRHYISEFDPKILRRCA-----------------
-------------KPRSHEAKSLIEKQSLALFGP--------------------------
---------------------------------------------EES---SKESIVTSF
SS-LKRLLL---------------------------------------------------
------------------------------------------EAVAFGTFLWDTEEYVDG
AFKLKENENAEE-------------ETNSS---V
>gi|18397912|ref|NP_566302.1|	   368 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---MDSCLSNQTA----------------------------------------LQFLPSR
SRRQS-----------------GDGGGGFV------IPAKRKIQYSSMVVVAAA---GQS
-RCE---PGSSLNAPLEPRSAQGRFLR-------------------SVLL---------N
KRQLFHYAAADELKQLADDREAALA----------------RMSLSSGSDEASLHRRIAE
LKERYCKTAVQDIMYMLIFYKYSEIRVPLVP---KLSRCI--Y-NGR-------------
------------------------------------------------------------
-------LEIWP-SKDWELESIYS-CDTLEIIKEHVSAVIGLRVNSCVTDNW-ATTQIQK
LHLRKVYAASILYG----------------------------------------------
----YFLKSASLRHQLECSLSDIHGSGYLKSP----------------------------
-IF---GCSFTTGTAQI-------------------------------------------
------------------------------------------------------------
---------------------SNKQQLRHYISDFDPETLQRCA-----------------
-------------KPRTEEARNLIEKQSLALFGT--------------------------
---------------------------------------------EE----SDETIVTSF
SS-LKRLVL---------------------------------------------------
------------------------------------------EAVAFGTFLWDTELYVDG
AYKLKENGNAEE-------------QEGKKS--I
>gi|15242177|ref|NP_197001.1|	   355 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---MAAASARAF-FMLSR----------VTDL-SKK---KLI-LHQPPPS---------S
SPHRL-----------------PYAP----------------------------------
------------------------------NRAVSSSAVISCLS----------------
------------------------------------------------------------
-------------------------------------------GGGVSSDDSYVSTR---
-------------------------------------------------RSKLDRGF---
AVIANLVNRIQP-LDTSVISKGL-SDSAKDSMKQTISSMLGLLPS---DQFS-VSVTISE
QPLYRLLISSIITG----------------------------------------------
----YTLWNAEYRVSLRRNFDIPIDPRKEEEDQSSKD---NVRFG---------------
------------------------------------------------------------
-------SE-KGMSEDLGNCVE-EFERLSPQVFGDLSPEALSYIQLLQSELSSMKE----
--ELDSQKKKALRIECEKG---NRNDLLDYLRSLDPEMVTELS-----------------
-------------QLSSPEVEEIVNQLVQNVLERLF--EDQTTSNFMQ--NPGI---RTT
EG-------------------------------------------GDG---TGRKVDTSR
DY-LAKLLF---------------------------------------------------
------------------------------------------WCMLLGHHLRGLENRLHL
SCVVGLL---------------------------
>gi|71032033|ref|XP_765658.1|	   489 residues, 50 /line  hypothetical protein TP01_0131 [Theileria parva strain Muguga]
-------------MIFGI----------TPK--WRR---A---------------PVIIL
LCYIF-----------------AY------FNNLV----------HCIHLIPSY---KLS
-FVG---YKFINKPRIPSEIRNFEPLISLPKHTENSFSLSSSFTLNSSFRLNSFFTDNLF
NRPFSPK--NLF-KSFFSNIFPSKFFSSSNLFNKSFFTSDSAKSCKN-KSPLANFWSSLK
SYLTSKFSSVKGTK------------VSAAP---KRFTRS--EPYPRNDLSEHHTRNDLS
EHHTRNDLTEPHTRNGELSDPYPRNNDLRHLSFFEFFDNPPDKVGDYKIRKEFNESMTQE
SPYMELVRTGPS--GIIKKFLKIAPSMVKDAISLTVSTLIGSFYR---YSAE-TTIITTT
DRLAALILNLQITG----------------------------------------------
----YIYCNAEQRYRLSTLYNLNPSTSPISSLNSQTN---------IGQPNVNQ---TNT
NQP---NVNQVNIGQCE----------------------------Q-KEDFEGLSV----
------------------------------------------------------------
-----------------------GDELLSYVRRLPRSYINGIF-----------------
-------------DNMNPEILYAMRYSTENAIQLLT--------------VLNH---NYL
DV-------------------------------------------KDH---QKLIIQQTG
SF-AMQLCF---------------------------------------------------
------------------------------------------WKLALGYCMRHQETKIEL
TKSLNSH---------------------------
>gi|84999722|ref|XP_954582.1|	   422 residues, 50 /line  hypothetical protein TA19020 [Theileria annulata strain Ankara]
-------------MIFGI----------KPK--WRR---A---------------PVIIF
LCYIF-----------------VH------FNNIV----------YCIHLIPSY---KLS
-FVC---YKWPNRFRTPPEVGDFEPLVSLREHTDHSFELNSS------------FTNNLF
NKPFFSK--NPFNKSFFSNIFPNKSLFLNNLFNKPFFNNYSKPCNKNDESILSNFWSSLK
SYVSSKFSSVKGST------------LCGNP---KRYTK---------------------
------------------SDAYLRNNDLRHLSFFDFFDNAPNNLGDYKIRKEFNESMTQE
SPYMELVRTGPS--GIIKRFLRVAPSMVKDAISLTVSTLIGSFYR---YSAE-TTIITTT
DRLAALILNLQVTG----------------------------------------------
----YIYCNAEQRYRLSSLCNPTGTSVPGGVMNNQLT---------DNQP----------
----------------E----------------------------P-RDEIEGLSV----
------------------------------------------------------------
-----------------------GDELLSYVRRLPRSYINGIF-----------------
-------------DNMNPEILYAMRHSTEKAIQLLT--------------VLNH---NYL
DF-------------------------------------------KDD---QKLIIQQTG
SF-AMQLCF---------------------------------------------------
------------------------------------------WKLALGYCMRDQETKIEL
TKSLNSH---------------------------
>gi|147794013|emb|CAN68920.1|	   299 residues, 50 /line  hypothetical protein [Vitis vinifera]
--------------MKGI----------KAG-----------------------------
------------------------------------------------------------
-----------------------QSAE-------------------ISIH---------W
MPPLM------------------------------------------LHTRLTRVRRIAA
VREKERQKVLEEILYCLIVQKFVDKNISMIP---KISATS--DPVGR-------------
------------------------------------------------------------
-------VDFWP-NQEQKLESIHS-PEAFEMIQSHLSLVLGERLV---GPLD-TIVQISK
IKLGKLYAASIMYG----------------------------------------------
----YFLKRVDERYQLERTMKTLPEGFNENRLS-------------FEDPGPAN---RLW
DPD---SLIRIPAD------D-------------------DDDGGM-LDSVEGG------
---------------SYRLRSY-VMYLDAETLQRYATIRSKEAISLIEKQTQALFG----
--K-----PDVRVSEDGSL--DTSN-----------------------------------
------------------------------------------------------------
----------------------------------------------------DEVVSITF
SG-LTMLVL---------------------------------------------------
------------------------------------------EAVAFGSFLWDSETYVES
KYHFLKS---------------------------
>gi|18398302|ref|NP_564389.1|	   406 residues, 50 /line  unknown protein [Arabidopsis thaliana]
--------------MQAI----------GSS--HGR---RLC-FNHYLSDSFSKFLSPSS
SPSLL-----------------PQRCHSFCIPKLGSSSTNENGRGRSV-TVRAS---GDE
-DSN---ENFAPLAPVELESPVGQLLE-------------------QILR---------T
HPHLLPVTVDEQLEKFAAESESRK--------------------ADSSSTQDILQKRISE
VRDKERRKTLAEIIYCLVVHRFVEKGISMIP---RIKPTS--DPAGR-------------
------------------------------------------------------------
-------IDLWP-NQEEKLEVIHS-ADAFEMIQSHLSSVLGDGPAV--GPLS-SIVQIGK
IKLGKLYAASAMYG----------------------------------------------
----YFLRRVDQRYQLERTMNTLPKRPEKTRER-------------FEEPSPPY---PLW
DPD---SLIRIQPE---EYDP-------------------DEYAIQ-RNEDESS------
---------------SYGLRSY-VTYLDSDTLQRYATIRSKEAMTLIEKQTQALFG----
--R-----PDIRILEDGKL--DTSN-----------------------------------
------------------------------------------------------------
----------------------------------------------------DEVLSLSV
SG-LAMLVL---------------------------------------------------
------------------------------------------EAVAFGSFLWDSESYVES
KYHFLKA---------------------------
>gi|68070179|ref|XP_677001.1|	   516 residues, 50 /line  hypothetical protein [Plasmodium berghei strain ANKA]
----------------ET----------RQK--WKK---H---------------LEDKR
RKEIL-----------------KH------INNMTKEKSNVNGKNKKKHIINKR---NTK
-QTN---YPIENDAHIEKEKKSHQDVE-------------------EE---------DDY
YEDEEEDYYEDEEEDYYEDEEDED------------EDYEES--YEDDEENIFNPDKPNE
VHNTKDSKRREENQYCKPHEYNIHSNYTNSPINNNINNAF--MPKKKNDFPLFFPTN---
-------------------------------------------------NKHFEKTN---
NKYFDKICSIPP-NELINLFFENT-RRVKEAVKNIIFNIIGNIQK---YALD-ISVLITY
DKIYNFLLQILLTG----------------------------------------------
----YMLKNADYRLSLNESLYDQNNQNNQKENSNFKK---YFNTIFSDNFKKPE---ELL
NSD---QLINTQSDNITNYDEEKKHENNTQNENNTIHIPVYEQNKN-INTHENNNYLSEN
DNNNN-SKI-HHNTKTDIGEEF-YTKFKQVTNEDLPIINTKNYIIFLKKKINSLEN----
--Q-------LKALKENKT--FQNDDLLSYIKSLTDIQLRSLT-----------------
-------------DNIGTVVLDATKKIVELVIQGMT-----LNV----------------
-N-------------------------------------------KNL---PNELIYTSG
SV-LTYICF---------------------------------------------------
------------------------------------------WQLIVGYTFREMEIRDEL
ADYFNTH---------------------------
>gi|70953945|ref|XP_746043.1|	   423 residues, 50 /line  hypothetical protein PC000671.02.0 [Plasmodium chabaudi chabaudi]
------------------------------------------------------------
-------------------------------NSLTKEKANIKGKKKKKHVINKR---NTK
-QTT-----IENDADIEKEKRSHENIE-------------------EEEEDEEEEDDDEY
YKDEGDNYYEEEEDDYYDEGEEEDDEEYEYGDEEDEYEGYED--EEDDEEDFFNPDKPNE
TDHVKDNKSVEGNRYYKPHQYNIHSNYSNSPINNNINNAF--MPKKKNDFPLFFPTN---
-------------------------------------------------NKHFEKTN---
NKYFDKICSIPP-NELINLFFENTPERVKEAVKNIIFNIIGNIQK---YALD-ISVLITY
DKIYNFLLQILLTG----------------------------------------------
----YMLKNADYRLSLNESLYDQNNQNNQKEIFNFKK---YFNTIFTDNFKQPG---EAL
NSG---ELINTQPDTITNYDEEKKNENNIQDETTNLHMPIYDQN---------NNYLSEN
DNNNNSSKI-QHNRKTDVGEEF-YTKFKQATNEDLPIINTKNYIIFLKKKITSLEN----
--Q-------LKALKENKT--FHNDDLLSYI-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|92883440|gb|ABE86960.1|	   356 residues, 50 /line  seed maturation-like protein, putative [Medicago truncatula]
---MAASTISSQPFILSR----------ITN--NPS---HPS-LHHPLPSLFFLRRPPHR
RPFLF-----------------ATSCHHVDG-----------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------DDVVSTR---
-------------------------------------------------KSTFNRGF---
TVISKMLRRIKP-LDNSVISKGV-SEASKDSMKQTISTMLGLLPS---DHFD-VTVSFEI
QPLHRLLVSSIITG----------------------------------------------
----YTLWNAEYRMSLTRNLEMSHADQGADCETPLE----SLELKGGE------------
------------------------------------------------------------
-EEHGETEK-VVSDLGLANSEI-CSSSTGAGVFGDLPPQALKYIQQLQSELTNMKE----
--ELNAQKQEMMQLEHDRG--I-RNNLLEYLRSFDPDMVTEMS-----------------
-------------RPSSEEVEDIIHQLVQNILRRFL--VDEASSNFME--QSVE---GNI
DD-------------------------------------------GDE---FSDKIATSR
DY-LAKLLF---------------------------------------------------
------------------------------------------WCMLLGHHLRGLENRLHL
SCVVGLL---------------------------
>gi|115450068|ref|NP_001048635.1|	   336 residues, 50 /line  Os02g0833400 [Oryza sativa (japonica cultivar-group)]
-----------MSPSLLL------------TSRGTHSP----------------------
-------------------APRPQTRRASQL-----LVSFPS------------------
------------------------------------------------------------
---RCSRFVGLRLARAAADSQGPNGA-APGSGSGGDGEGKAANGAD--------------
------------------------------------------------------------
-------------------------------------------------TKLPKNRR---
DILLEYVKNVQP-EFMELFIKRA-PPQVVDAMRQTVTNMIGTLPP---QFFA-VTVTTVA
ENLAQLMYSVLMTG----------------------------------------------
----YMFRNAQYRLELQQSLEQIALPEPKEEN-DSADYAP--------------------
------------------------------------------------------------
GTQKKVTGE-VIRWN---------------KTTGPEKIDAVKYIELLEAEIDELSH----
--------------QVARKSSQGSNELLEYLKTLEPQNLKELA-----------------
-------------SSAGEDVVFAMNAFIKRLLAVSDPAQMK-------------------
----------------------------------------------------TTVSETSA
NQ-LANLMF---------------------------------------------------
------------------------------------------WLMIVGYSMRNIEVRFDM
ERVLGAAPKIGE-------------LPPGEN--I
>gi|125584283|gb|EAZ25214.1|	   193 residues, 50 /line  hypothetical protein OsJ_008697 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------M-----QEFIRS------------------
------------------------------------------------------------
---RTIMLVG--------------------------------------------------
------------------------------------------------------------
-------------------------------------------------LDSPKNRR---
DILLEYVKNVQP-EFMELFIKRA-PPQVVDAMRQTVTNMIGTLPP---QFFA-VTVTTVA
ENLAQLMYSVLMTG----------------------------------------------
----YMFRNAQYRLELQQSLEQIALPEPKEE-----------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------NELA-----------------
-------------SSAGEDVVFAMNAFIKRLLAVSDPAQMK-------------------
----------------------------------------------------NH------
----AYLHF---------------------------------------------------
------------------------------------------VELCHSFSMRNIEVRFDM
ERVLGAAPKIGE-------------LPPGEN--I
>gi|42562912|ref|NP_176549.3|	   340 residues, 50 /line  unknown protein [Arabidopsis thaliana]
--------MCSLSMQFSL------------LQSPPSRP----------------------
-------------------CPSFLANHEPKLSTTSSSVTFPL------------------
------------------------------KTNTW-------------------------
---KCSGTGNLLVLRVKAY------------GSSSDSSADSSTPPNG-------------
------------------------------------------------------------
-------------------------------------------------TRQPKSRR---
DILLEYVQNVKP-EFMEMFVKRA-PKHVVEAMRQTVTNMIGTLPP---QFFA-VTVTSVA
ENLAQLMMSVLMTG----------------------------------------------
----YMFRNAQYRLELQQSLEQVALPEPRDQKGGDEDYAP--------------------
------------------------------------------------------------
GTQKNVSGE-VIRWN---------------NVSGPEKIDAKKYIELLEAEIEELNR----
--------------QVGRKSANQQNEILEYLKSLEPQNLKELT-----------------
-------------STAGEDVAVAMNTFVKRLLAVSDPNQMK-------------------
----------------------------------------------------TNVTETSA
AD-LAKLLY---------------------------------------------------
------------------------------------------WLMVVGYSIRNIEVRFDM
ERVLGTQPKLAE-------------LPPGEI--I
>gi|6633836|gb|AAF19695.1|AC008047_2	   222 residues, 50 /line  F2K11.3 [Arabidopsis thaliana]
--------MCSLSMQFSL------------LQSPPSRP----------------------
-------------------CPSFLANHEPKLSTTSSSVTFPL------------------
------------------------------KTNTW-------------------------
---KCSGTGNLLVLRVKAY------------GSSSDSSADSSTPPNG-------------
------------------------------------------------------------
--------------------------------------------------TRPKSRR---
DILLEYVQNVKP-EFMEMFVKRA-PKHVVEAMRQTVTNMIGTLPP---QFFA-VTVTSVA
ENLAQLMMSVLMTG----------------------------------------------
----YMFRNAQYRLELQQSLEQVALPEPR-------------------------------
------------------------------------------------------------
---------------------------------------GITYLALRKLMQKSISS----
--------------FWKQRS-------------------KNST-----------------
-------------VKWGE------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------NQRISR-------------MKSWSI---

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.