FANDOM


>gi|18397658|ref|NP_565366.1|	   141 residues, 50 /line  SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
-----------------------------------MAVSSGTFS----------------
----TFLCIKTTSFRN--PSTPLSSL--RFASH----------PA--------AKLRLVR
AVTS-A-TE-SSE-----P-TATNKRVPRGIMKPRPVSPEMQDIV-ELPEIARTQALKRI
WAYIKEHDLQDPQNKREILCDEKLKKIFEGR----DRV-GFLEIAKLIGPHFL-------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|108762999|ref|YP_629784.1|	   105 residues, 50 /line  DNA topoisomerase domain protein [Myxococcus xanthus DK 1622]
------------------------------------------------------------
----------------MAAKK----------------------------------AAAKK
A------PA-AKKAPAA-K----KRTPNASFMKEMTPSAALAEIV-GAKPLPRTEVVKKL
WAYIKKQGLQDAKNKRQINADDKLKPIFGGK----KSV-TMFEMTALVNKQLS-------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|121594745|ref|YP_986641.1|	   96 residues, 50 /line  SWIB/MDM2 domain protein [Acidovorax sp. JS42]
------------------------------------------------------------
----------MA--------------------TAKTASAAPAKK----------------
------------------------RTPNAAFMKPLTPSPALAAVV-GATPLPRTEIISKL
WVYIKAHNLQDASNKRMINADAKLKEVFG-K----PQV-SMFEMAGLIGKHVK-------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|42522857|ref|NP_968237.1|	   140 residues, 50 /line  hypothetical protein Bd1337 [Bdellovibrio bacteriovorus HD100]
------------------------------------------------------------
----------MAKA--KATKKATTKKAAPKKAVAKKAAPKAAKKAAP-------KAAAKK
AAAP-------KKAAAP-KKAKTARKPNAAFMKALTPSAALAAVV-GASPLPRTEVVKKL
WAYIKKNNLQDTKNKRNINADAKLKEVFGGK----TQV-SMFDMTKLVSKHLK-------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|134095941|ref|YP_001101016.1|	   150 residues, 50 /line  hypothetical protein HEAR2779 [Herminiimonas arsenicoxydans]
------------------------------------------------------------
----------MATAKKPAAKKPAAKKPVAKKVVAKKAA--PAKKAAPAKKVAAKKPVAKK
VAVK--KPA-AKKVAA--KKPATARKPNAAFMKPVTPSTVLAAVI-GAAPAPRTEVTKKV
WEYIKKFKLQNPENKRMIDADDKLKAVFGGK----KQV-SMFEMTKLISGHLK-------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|33593966|ref|NP_881610.1|	   92 residues, 50 /line  hypothetical protein BP3037 [Bordetella pertussis Tohama I]
------------------------------------------------------------
----------MAT---------------------------------PS------------
-------------------KTATARKPNAAFMKPLTPSAELAAVI-GSEAVPRTEVTKKI
WDYIKKHNLQDASNKRNINADAKLRPIF-GK----DQV-TMFELTKLVNAHLK-------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|115372432|ref|ZP_01459741.1|	   106 residues, 50 /line  SWIb domain-containing protein [Stigmatella aurantiaca DW4/3-1]
------------------------------------------------------------
---------------------------------------------------MAAKKAAAK
KTAAK-------KAAPAAKKAAGAKKPNAAFMKEFNPTPELAAVV-GDKPLPRTAVIKKL
WDYFKKNGLNQG---QLINLDDNLKKVYGNK----KQ-IKMTEVAGAF------------
------------------------------------------------------------
-------------------------KHLK-------------------------------
-----------------------E
>gi|6523091|emb|CAB62349.1|	   205 residues, 50 /line  putative protein [Arabidopsis thaliana]
-----------------------------------MSP----------------------
---------------------------------------------------ISKILGGCR
TLMAK-------AVTNATATGAGVDR-RGGIHKIFPVSESLARFV-GQSEVSFSTAMEKV
EQYTDDHNLWNPENIEEILCDDNLKTIFDGQ----DKVVGVREMTELLLRHFPNV-RTMS
A--KVKATGGGTIEKWG----FNDIVKVSEPL----------------------------
------ARFVGQSEISFDAALRKLLDYAFDHKLVDEGVTLLE---------------FPW
VSFFTFLMISSLHVYA--FRDWSL
>gi|38047929|gb|AAR09867.1|	   133 residues, 50 /line  similar to Drosophila melanogaster CG1240 [Drosophila yakuba]
--------------------------------TKHKAP----------------------
-------------------KKKRKTLNADDSGTESD-------------AGSDSDYEVVK
KPAAK-------KKAKA-AGGAGSGRKSTGFTRAYNLSPELSALM-GESSLPRHEVVKKV
WAIIKERDLYDPKNKQFAICDDELMKVMKIR-----RF-RTFGMLKHLKPHFL-------
------------------------------------------------------------
------------------------------------------------------------
-----------------------D
>gi|18398106|ref|NP_564382.1|	   112 residues, 50 /line  SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
-----------------------------------MAG----------------------
---------------------------------------------------ISRVLGGFR
TLMSK-------AATVEAVTVAG---EGKGIFKTRPVSQQLASFA-GERELTRGSALKKV
WEYVKLHNLQNPANKKEIHCDDKLKTIFDGK----DKV-GITEIMKLLSPHFPKS-----
------------------------------------------------------------
------------------------------------------------------------
-----------------------V
>gi|18403898|ref|NP_565810.1|	   109 residues, 50 /line  SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
------------------------------------------------------------
---------------------------------------------------MSRVFGACR
VLMAK----------AASSTGAKTGRQGTGILKVVPVSKPLANFI-GENEVSRTTAVKKI
WEYIKLNNLQNPVNKREILCDEQLKTIFSGK----DTV-GFLEISKLLSQHFPKS-----
------------------------------------------------------------
------------------------------------------------------------
-----------------------A
>gi|125590137|gb|EAZ30487.1|	   213 residues, 50 /line  hypothetical protein OsJ_013970 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------MEVL-GVEVDTRSRVIAAL
WQYIKAKKLQNPTDPSFFMCDPQLKKVF-GE----DKL-RFAMLSQKISQHLSPP-PPIN
LEHKIKLSGNGAHASACYDVIVDVPFPLQKEMSAFLANTEKHKDIEACDEVISASIKKIH
EHRRRRAFFLGFSQSPVEFINALIASQSKDLKLIAGEANRNIERERRADFYNQPWVEDAV
IRYLNRKPASGNEGPG--GGAGGS
>gi|48425871|pdb|1V31|A	   93 residues, 50 /line  Chain A, Solution Structure Of The SwibMDM2 DOMAIN OF THE Hypothetical Protein At5g14170 From Arabidopsis Thaliana
------------------------------------------------------------
------------------------------------------------------------
-----------------------GSSGSSGVPEKFKLSTALMDVL-GIEVETRPRIIAAI
WHYVKARKLQNPNDPSFFNCDAALQKVF-GE----EKL-KFTMVSQKISHHLSPP-PPS-
------------------------------------------------------------
------------------------------------------------------------
-------------GPS--SG----
>gi|33667910|gb|AAQ24534.1|	   148 residues, 50 /line  SWIb domain-containing protein [Solanum chacoense]
----------------------------FLRTKNLEFTISPLLAFRVLQNPRKTMASSSR
IFGNYCR----------------------------------------------TLMAAAK
TSAG-------KTPPATT-TTAAGKGRSKGILKPQPISPALQKFV-GTSEISRTDAVKKI
WDYIKTNNLQNPANKKEINCDDMLKTIFAGK----DKV-GFLEIAKLLSFHFQKA-----
------------------------------------------------------------
------------------------------------------------------------
-----------------------S
>gi|147798865|emb|CAN68050.1|	   128 residues, 50 /line  hypothetical protein [Vitis vinifera]
------------------------------------------------------MSGIAM
GFFKNSR----------------------------------------------VLLAAAR
SSSSPAAAT-KKTPAPPR-TAAKGPPRSGGITKPVPVSPALRKFL-GVPEASRAEAVKKI
WEHIKLNNLQNPTNKREILCDEKLKSVFEGK----DKV-GFLEIGKLLSHHFIKT-----
------------------------------------------------------------
------------------------------------------------------------
-----------------------V
>gi|115455497|ref|NP_001051349.1|	   144 residues, 50 /line  Os03g0761000 [Oryza sativa (japonica cultivar-group)]
-----------------------------------MASASMLSA----------------
----ASLSLSPSPLAALRPPRPAA-----SFALPRR-------------------AAAAA
VAVRAAAAA-SNSP----AAAAQKKRAATGLTKPRLVSPALQAVV-GAAEIPRTEALKRL
WAYIKQHNLQDPADKKVIVCDEKLKVLFAGQ----ERV-GFLEVAKLLNPHFVK------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|46445959|ref|YP_007324.1|	   98 residues, 50 /line  hypothetical protein pc0325 [Candidatus Protochlamydia amoebophila UWE25]
------------------------------------------------------------
------------------------------------------------------------
------------------MTKDTKDKKNSAFMRPVQVSEVLAEIV-GNGPMPRTEVTKRV
WDYIKKNKLQDQTNKRNINPDAKLGKVLGSD----QSI-DMFKMTSKIAKHLKEP-----
------------------------------------------------------------
------------------------------------------------------------
--------------EM--SSTK-Q
>gi|18396594|ref|NP_566210.1|	   143 residues, 50 /line  SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
--------------MSSVAAMVFRGARSLLAP----------------------------
----------------------------------------ASRATSSLVSA----GSTKK
PAAKPKAKA-KPKPKAKSDSPAKKTPRSTGIFKVTPVSPVLAQFL-GTGETSRTDAIKGI
WTYIKSHDLQNPADKREIFCDETLKLIFEGK----DKV-GFLEISKLLSPHFVKT-----
------------------------------------------------------------
------------------------------------------------------------
-----------------------A
>gi|19075845|ref|NP_588345.1|	   233 residues, 50 /line  hypothetical protein SPCC285.17 [Schizosaccharomyces pombe 972h-]
------MEEYET----DIKQILGTVDRQTVSAKQVRQLLEERRKVDLSAH-KKDLNALIL
KCFDETAAPS---EKESLEKQ-----APARKTKGKRATENGTEEGKK----PAKRTRK--
---RKEDGE-EGG-----KRKRNQDPANNPLNKPMKLSPKLAEFL-GLEQLSRPQTVKKL
WEYIKAHDLQDPNDKRTILCDDKLKSVFE-V----DTL-HMFTMNKYLTNLMTKIPDDQL
PKP---------------------------------------------------------
--------------------------------------------------QPKNEEPAAP
NDLPKQEEKELVE-PP--TAESTA
>gi|94496660|ref|ZP_01303236.1|	   113 residues, 50 /line  hypothetical protein SKA58_18187 [Sphingomonas sp. SKA58]
------------------------------------------------------------
----------------------------------------------------MAKSAEKR
GKDETKAAE-KTV---K-ATGKKAGGARGGITAPVTPSPELAEIV-GDKDLPRSEVVSKV
WDYIKKHDLQDAKDRRQINADAKLEKIFGK-----KSV-SMFEMNKHLSQHLTAK-K---
------------------------------------------------------------
------------------------------------------------------------
-----------------------A
>gi|56753700|gb|AAW25047.1|	   100 residues, 50 /line  unknown [Schistosoma japonicum]
------------------------------------------------------------
--------------------------------------------------------MRRR
SGC-------NSKPKQQ----KQPGSGKTGFTRPLLLSDELAEYV-GAKELSRSDLVKKF
WKIAKEQDLFDPNNKQFVVCNEDWQRLFNLK-----RF-RMFGVAKHLKRHIIG------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|149243917|ref|XP_001526546.1|	   141 residues, 50 /line  conserved hypothetical protein [Lodderomyces elongisporus NRRL YB-4239]
------------------------------------------------------------
-----------MQNE--QARKEKEEVER-------TDALLAAKLLREESS-NGAGTRASR
TKRRSSSTN-GSSPSSS-LKPTKRAAPNNAFNREMVLSSDLQNVI-SELTCSRPQVVKRL
WAYIKDNNLQNPTDKRQIICDDKLQQLFKKSMF---------STLGYFFSFYSF------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|85374762|ref|YP_458824.1|	   82 residues, 50 /line  hypothetical protein ELI_09675 [Erythrobacter litoralis HTCC2594]
------------------------------------------------------------
------------------------------------------------------------
------------------------MAGNNALQKPVTLSPELENVV-GKGPMTRAQVTSKV
WEYIKKHDLQDSKDKRQINPDDKLGAVIG-K----EQI-SMFKMTAAVSKHLS-------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|149120936|ref|ZP_01847375.1|	   120 residues, 50 /line  SWIB/MDM2 domain protein [Methylobacterium sp. 4-46]
------------------------------------------------------------
---------------------------------------MATKTTKKEAPKAEAAEAEKP
AGK---ESA-AKG-KKV-AA-PKGGDKPNALQKPLQPSPELGAIV-GTKPIPRGEVVSKV
WDYIRTHSLQNPENKREILADDKLKKVFG-K----DKA-TMFEMNKYLAQHLK-------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|46204853|ref|ZP_00049390.2|	   106 residues, 50 /line  COG5531: SWIB-domain-containing proteins implicated in chromatin remodeling [Magnetospirillum magnetotacticum MS-1]
------------------------------------------------------------
---------------------------------------MATKTTEK-------------
------KAA-APK-KET-ATKAASGTKPNALQQPLKPSPELAAIV-GDKPLPRGEVVSKV
WEHIKKHNLQNPENKREIVADDKLKKIFG-K----DKC-SMFEMNKHLAAHLKS------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|50294301|ref|XP_449562.1|	   233 residues, 50 /line  hypothetical protein CAGL0M04939g [Candida glabrata CBS138]
MDQNIDLNNYVS----MLDAIISVSDPDKVSPKKIRKALEQLFSVSLENK-KKEVNELIV
ARFQILQADPHILVS--NEEFQNLKMIR-----GNYDALLSSKSMEKKH-KLTESSKKTR
IQVKKKKSK-KSS-KDG-EKKVANPNSNAINSMKLRLSDDLYKFL-GERELPRTQVVKQV
WDYIKEHNLQSPEDRREIICDDRMRPIFGD------KM-TMFALNKILSKHLTKI-EPKS
EE----------------------------------------------------------
------------------------------------------------------------
-ADNSRLSVKLED-------GTQA
>gi|6323889|ref|NP_013960.1|	   226 residues, 50 /line  Protein of unknown function with similarity to components of human SWI/SNF complex including SMRD3; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm, nucleus and nucleolus; YMR233W is not an essential gene [Saccharomyces cerevisiae]
---MADINKYIP----MVDAILSVSNPDEISPKRVRKALQILYSVNLDSQ-RKLINELIL
ERFGDIQENP-------RVLIPKNDLIS-------RDQELSLRLQKEEER-PLRSTRKRK
GKS--ESKS-KRK-----KKKNDSPDSNSISVRKVLLSAPLQKFL-GSEELPRTQVVKMI
WQYIKEHDLQNPKDRREILCDEKMEPIFGK------KM-TMFSMNKLLTKHLFNP-DEIV
KHE---------------------------------------------------------
--------------------------------------------------EEQKQTPEK-
-------EIKLE-NES--LPNLSG
>gi|6324869|ref|NP_014938.1|	   228 residues, 50 /line  Subunit of UAF (upstream activation factor), which is an RNA polymerase I specific transcription stimulatory factor composed of Uaf30p, Rrn5p, Rrn9p, Rrn10p, histones H3 and H4; deletion decreases cellular growth rate [Saccharomyces cerevisiae]
---MAELNDYST----MIDILLSDMDLETVTTKKVRMALKEVYAIDVESQ-GKAINKLIR
KHLD-LVKERPRFER------SLEDLLK-------ENATLAIELTKEIT-VSKRSSGEEK
NDSETKGTH-VEK-----KK--GTVSKSPISTRKVTLSKSLASLL-GEHELTRTEVVRRL
WAYIKAHNLQNPNNKKEILCDEKLELILGK------ST-NMFEMHKILASHMTEP-KKIS
------------------------------------------------------------
------------------------------------------------------DCPPLI
QEVRRKEKPIVSDSEQ--SDTKGI
>gi|45185215|ref|NP_982932.1|	   220 residues, 50 /line  ABL015Cp [Ashbya gossypii ATCC 10895]
MYAPHFFGSFKHLLTPLPKAILSVSDPDEISAKRIRKALQELFAVDLDGD-KKDIKALIL
ERFDLLRDRQSKVL-------SQEELVQ-------RDSEMAAALVRGDAGR-------AK
RPRKRDADK-PRK-----KRANQSDNPNSFHMRPVQLSEPLQRLL-GEEQLPRTQVVKAV
WDYIKQHQLQNPDDRREILCDAAMEPVFGK------KM-TMFSMNKILSQHLTNP-KDVS
GSD---------------------------------------------------------
------------------------------------------------------------
QDANTEEHSD----------QLSA
>gi|50304323|ref|XP_452111.1|	   124 residues, 50 /line  unnamed protein product [Kluyveromyces lactis]
------------------------------------------------------------
------------------------------------------------------MLKRHR
SGKKEKKPK-KKK-----KRKVANDNPNSIHLKKVGLSPELQEFL-KVEEMPRTQVVKSV
WDYIKEHDLQNPEDRREIICDDAMKPIFGE------KM-TMFTLNKILSKHLFNL-AKSE
KD----------------------------------------------------------
------------------------------------------------------------
--EITEQHSDLEP-----------
>gi|68473744|ref|XP_718975.1|	   136 residues, 50 /line  hypothetical protein CaO19_6013 [Candida albicans SC5314]
------------------------------------------------------------
-------------------------MER-------QDALLAAKLSREEMGRFGKRTIRKA
TQTASKIKS-SKS-----KSNTKRSAPNNAFNREMALSPELTNVI-GVDKCSRPQVVKLL
WAYIKDHNLQNPQDKRQIECDEKLQKLFKKSMLHYNVI-HIYITRSIVDKNFTNQ-----
------------------------------------------------------------
------------------------------------------------------------
-----------------------K
>gi|50428259|ref|XP_460791.1|	   139 residues, 50 /line  hypothetical protein DEHA0F10780g [Debaryomyces hansenii CBS767]
----------------------------------------------------KEINEVIL
ERYYDLVNKRKEDTR--TEEERKKEVEK-------QDALMAVRLLKSNL--------KTP
VKRQKKASP-KKT-----KEKDPAKNRNSAFFQEQHLSNELADVL-GVEKCSRPQVVKQL
WTYIKDNNLQNPDDKRQIICDTKLQALFKKS----M---LFF------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|146412011|ref|XP_001481977.1|	   185 residues, 50 /line  hypothetical protein PGUG_05740 [Pichia guilliermondii ATCC 6260]
------MRSIVTLL--LTQAILSVADLEKITVKKIRHALQELFSVDLQPN-KKAINDVIL
NRYYDLVSRRSQEND--SEEDRKAEIIK-------QDEIMAQKLQGEML----SRTPGRR
KAAPKRKNS-TTN-----NSGATKPPSKTGFNREMALSSQLQEVI-GEEKCSRPRVVKLL
WAYIKDRDLQNPQDKRQINCDEKLTALFKKS-----KL-S--------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|50288521|ref|XP_446690.1|	   241 residues, 50 /line  unnamed protein product [Candida glabrata]
MAPQYISEEYES----MIDAVLTYCD-EEVSLNSLRAQLNEVFSLNIKSF-DL-------
-NLRTLVDKKLEAFKNVTEKPKVKDISTDKVMTENRRYINVIKQT---L----KEAELKK
EGITVTKVQ-KPK-----LKLKVTNSKKSMIHIKMTVTPELQAVI-GTHYQSRTEIVRNL
WKYIKEHNLQNPDDKRQIISDAMLEPVLGKT----S---DIFMMHRALKHHILGP-APIE
AEV----------------------------------------------------IR---
--------------------------------------------------TDQESTPSLA
SESSEQEHADSTDTSD--SVYYST
>gi|115488718|ref|NP_001066846.1|	   55 residues, 50 /line  Os12g0507500 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
--------------------------------MDHKYKIQVA------------------
-------------------------------------------FVVG-------------
--------TQDPNNKKIIVCDEKLKKIFGGR----DRV-GFLEISGLLNPHFQK------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|125579472|gb|EAZ20618.1|	   158 residues, 50 /line  hypothetical protein OsJ_034827 [Oryza sativa (japonica cultivar-group)]
---------MSA-----------------------TATAAAIRS----------------
---GELLACPM-ALRR--AAAPVAAA--MSFRMGRAATARAGRLA--------TRVR-VR
VVAAAEEGA-AEG-----KSSGKKKRAASGIMKPKPISAELREFVGGAEELPRTEALKII
WAHIKGNNLQDPNNKKIIVCDEKLKKIFGGR----DRV-GFLEISGLLNPHFQK------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|147843362|emb|CAN78429.1|	   145 residues, 50 /line  hypothetical protein [Vitis vinifera]
-----------------------------------MAMSLGVXS----------------
----TFFSGETASFSK--SALSLTSL--RHLPPPS--------PH--------TNLRLVR
TVTS--AAA-SKP-----PAAATGKREPRGIMKPRRISPEMQDFL-GVPEIPRTQALKQI
WAYIKQHNLQDPENKKIIVCDEKLKSIFAGK----DRV-GFLEIAGLINPHFLK------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|21553903|gb|AAM62986.1|	   144 residues, 50 /line  unknown [Arabidopsis thaliana]
-----------------------------------MALSSGIFS----------------
---ITFLCVDTAPLRI--SMLSPSSL--R-LSPNH--------P---------TNLRMVR
AVTS-AAAA-SSD-----PTTTTKTREPRGIMKPRPVSQAMQDVV-GVPEIPRTQALKRI
WAYIKEHDLQDPQNKRDILCDEKLKKIFEGK----ERV-GFLEIAKLIGPHFL-------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|150866001|ref|XP_001385450.2|	   149 residues, 50 /line  predicted protein [Pichia stipitis CBS 6054]
-----------------------------------KSINDLILG----------------
-RYYDLVDKRAEEEKY--EKKRLEEI--GR-----QDALMAARLS--------KSEINGP
VMRARTVLA-KRK-----KKREAGTLAKTGFNKEMVLSTELSDIL-GISRTSRPQVVKQL
WIYIKDNELQNPDDKRQIMCDEKLQKLFKKS----MCN-FCLEIFVIFSY----------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|15835359|ref|NP_297118.1|	   86 residues, 50 /line  hypothetical protein TC0745 [Chlamydia muridarum Nigg]
------------------------------------------------------------
------------------------------------------------------------
----------------------MSQNKNSAFMQPVNVSSDLAAIV-GTGPMPRTEIIKKI
WDYIKQNKLQDPTNKRNINPDDKLAKVFGSK----DPV-DMFQMTKIVSKHIVK------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|29839931|ref|NP_829037.1|	   87 residues, 50 /line  BAF60b domain protein [Chlamydophila caviae GPIC]
------------------------------------------------------------
------------------------------------------------------------
---------------------MSQKNKNSAFMNPVNITPDLAAIV-GEGPMPRTEIVKKV
WEHIKKNNLQDPKNKRNILPDDALAKVFGSK----NPI-DMFQMTKALSAHIVK------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|109096592|ref|XP_001111021.1|	   229 residues, 50 /line  PREDICTED: similar to SWI/SNF-related matrix-associated actin-dependent regulator of chromatin d1 isoform a isoform 2 [Macaca mulatta]
------------------------------------------------------------
------------------------------------------------------------
--------------------------MLDYQPPQFKLDPRLARLL-GIHTQTRPVIIQAL
WQYIKTHKLQDPHEREFVICDKYLQQIFE-S----QRM-KFSEIPQRLHALLMPP-EPII
INHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATLDNKIHETIETIN
QLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVG-NPEEERRAEFYFQPWAQEAV
CRYFYSKVQQRRQELEQALGIRNT
>gi|26386246|dbj|BAB31685.2|	   224 residues, 50 /line  unnamed protein product [Mus musculus]
------------------------------------------------------------
------------------------------------------------------------
-------------------------------PPQFKLDPRLARLL-GLHTQSRSAIVQAL
WQYVKTNRLQDSHDKEYINGDKYFQQIFD-C----PRL-KFSEIPQRLTALLLPP-DPIV
INHVISVDPSDQKKTACYDIDVEVEEPLKGQMSSFLLSTANQQEISALDSKIHETIESIN
QLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAG-NPEEERRAEFYHQPWSQEAV
SRYFYCKIQQRRQELEQSLVVRNT
>gi|115478068|ref|NP_001062629.1|	   102 residues, 50 /line  Os09g0133000 [Oryza sativa (japonica cultivar-group)]
------------------------------------------M-----------------
--------------------------------VLRRATAAVGD-----------------
-----------------------CPKKVAKLVDLVNLPTALREFAGGQSQMSHLSFFLRV
WSHIKSNNLQDPSNRNIVNCDDKLKTVLLGR----SKV-ELSELPMLVKLHFPKF-PK--
------------------------------------------------------------
------------------------------------------------------------
-----------------------S
>gi|148802649|gb|EDL44048.1|	   140 residues, 50 /line  hypothetical protein, conserved [Plasmodium vivax]
-----------------------------------MDSIRRNI-----------------
--------------------------------LSGRLCTTLGIKFQP-------RDFPKF
YAKNHFSTDNEEKSETKGKHTNVKEKKPNGLQIDCEIKSPLKEFL-NTDTASRVFVLKYA
WKYIKENNLQNPNTKRKIIPDEKLKNVLE-K----DEV-DMLEVPKLLFRHMSSI-RK--
------------------------------------------------------------
------------------------------------------------------------
-----------------------E
>gi|83314990|ref|XP_730600.1|	   111 residues, 50 /line  hypothetical protein [Plasmodium yoelii yoelii str. 17XNL]
-----------------------------------MNTVRAKF-----------------
--------------------------------FIPKNKIIGHGSFSP---------LNKF
MTKYNYSTS-------DKNNENIKEKKPNGLQIDCEIKSPLKEFL-NTDTASRVFVLKYA
WKYIKDNNLQDPDMKRKIIPDQKLKQVLE-K----DG-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------
>gi|15236880|ref|NP_194411.1|	   106 residues, 50 /line  SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
------------------------------------------M-----------------
--------------------------------LPQRLKKAITD-----------------
-----------------------NPKKLGNLIDLVNLPSTLRNFV-GQSQISRLGCFMRV
WSYIKTNNLQDPKNKNVVICDEKLKSILLGK----QRV-ELVDLPSLIKLHFPKE-Q---
------------KKNS--------------------------QKI---------------
------------------------------------------------------------
------------------------
>gi|91107221|gb|ABE11612.1|	   100 residues, 50 /line  SWIb domain-containing protein [Solanum chacoense]
------------------------------------------M-----------------
--------------------------------LPQRMKKVMTD-----------------
-----------------------NPKKLANLIDLVNLPSTLREFM-GQSQTSRLGCFKRV
WSYIKENNLQDPNNKNLVNCDEKLKSVLLGK----PQV-ELTELPTLIKLHFPKQ-P---
------------R-----------------------------------------------
------------------------------------------------------------
------------------------
>gi|115444003|ref|NP_001045781.1|	   131 residues, 50 /line  Os02g0130000 [Oryza sativa (japonica cultivar-group)]
-----------------------------------MAAAARVF-----------------
--------------------------------RGCRFLMAAAGGKRP---------ASAS
ASA-------SAAGAKVTKTEAAQAKEKRGIMQPVPVSDALSRFAGGAPEMSRAGAVKLI
WNHIKANGLQNPANKREINCDDKLKSLFAGK----DKV-GMMEIAKLLSPHFIKA-----
------------------------------------------------------------
------------------------------------------------------------
-----------------------N

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.