Fandom

Proteins Wiki

At2g14750.1/MSA

< At2g14750.1

47,923pages on
this wiki
Add New Page
Talk0 Share

>gi|15225999|ref|NP_179082.1|	   276 residues, 50 /line  APK (APS KINASE); ATP binding / kinase/ transferase, transferring phosphorus-containing groups [Arabidopsis thaliana]
MIA--AGAKSLLGLSMAS-PKGI-FDSNSMSNSRSVVVVRA----CVSMDGSQTLSHNK-
--------NGSIPEVKSI----------------------------------------NG
HTGQKQGPLSTVGNSTNIKWHECSVEKVDRQRLLDQKGCVIWVTGLSGSGKSTLACALNQ
MLYQK-GKLCYILDGDNVRHGLNR-----------------DLSFKAEDRAENIRRVGEV
AKLFADAGIICIASLISPYRTDRDACRSLLPE-G--DFVEVFMDVPLSVCEARDPKGLYK
LARAGKIKGFTGIDDPYEPPLNCEISLGREG----GTSPIEMAEKVVGYLDNKGYLQA--
------------------------------
>gi|109897971|ref|YP_661226.1|	   198 residues, 50 /line  Adenylylsulfate kinase [Pseudoalteromonas atlantica T6c]
------------------------------------------------------------
------------------------------------------------------------
-------------MENNIVWHQHEVDKRRRADAKGQKPCVVWLTGLSGSGKSTIANLLEK
KLADN-GKHTYLLDGDNVRHGLNG-----------------DLTFSDKDRVENIRRISEL
SKLFVDSGLIVITAFISPFKSERDYCRSLLEQ-N--EFVEVFVDTPLEECEKRDPKGLYQ
KARSGEITDFTGISSPYEAPESPEITLNFSG-----QSAQESAEQLFTQLKQKGLID---
------------------------------
>gi|67153504|ref|ZP_00415249.1|	   198 residues, 50 /line  Adenylylsulfate kinase [Azotobacter vinelandii AvOP]
------------------------------------------------------------
------------------------------------------------------------
-------------MTKNLSWHASSVGKLQRAGGKRQKPCILWLTGLSAAGKSTIANLLEQ
ELFLC-GAHTYLLDGDNLRHGLNR-----------------DLGFADADRQENIRRAAEV
AHLFVDAGIIVIAAFISPFRRDRELARRLVAP-G--EFLEIFVDTPLEECERRDPKGLYR
RARCGLISHFTGIDSAYEVPLDPEMRLTTLG-----WTPAQNACAIVDYLREGGYLR---
------------------------------
>gi|110601705|ref|ZP_01389879.1|	   203 residues, 50 /line  adenylylsulfate kinase [Geobacter sp. FRC-32]
------------------------------------------------------------
------------------------------------------------------------
----------MGANRLNITWHDRVLTKGDYLKRNGHQPLVLWFTGLSGSGKSTLAHAVEE
ELFRK-GCYTYILDGDNIRHGLNS-----------------DLGFSEADRRENIRRIGEV
AKLFVDAGIIVLAAFISPYREDRERVRALFEP-A--EFIEVFVNCDLAVCESRDPKGLYR
KARSGELKQFTGIDSPYEVPFSPELVVNTAC-----STVKSGVQSVLAFVRDRGLINGD-
------------------------------
>gi|22299855|ref|NP_683102.1|	   201 residues, 50 /line  adenylylsulfate kinase 1 [Thermosynechococcus elongatus BP-1]
------------------------------------------------------------
------------------------------------------------------------
----------MSNPRENIIWHQATVTRARREQLNGHKSCVLWFTGLSGAGKSTLAHAVEE
RLHQL-GYRTFVLDGDNVRHGLCS-----------------DLGFTESDRKENIRRIGEV
AKLMMEAGLIVMTAFISPFRADREAVRNRMPH-G--DFLEIYCQASLEVCEARDVKGLYK
RARAGEIKNYTGIDSPYEPPLKPELIVNTEC-----LTLEESVGAVLRMLQERGVVQ---
------------------------------
>gi|149092478|ref|ZP_01838369.1|	   199 residues, 50 /line  cysC [Clostridium kluyveri DSM 555]
------------------------------------------------------------
------------------------------------------------------------
----------MNVKSTNISWHRALVDREMREKLLGQNGILIWFTGLSGSGKSTIASELEM
RLYNM-GRLTYLLDGDNVRHGLNS-----------------NLGFTKEDRIENIRRTAEV
CKLFVDSGIITISTFISPFKDDRDKVRKLLGK----DFVEVYVDCPLEVCESRDPKGIYK
KARNGEIKDFTGVDSPYEVPDNPEIVVSTNL-----DTVQQCVNKILDFLSCKVQE----
------------------------------
>gi|15893399|ref|NP_346748.1|	   200 residues, 50 /line  Adenylylsulfate kinase [Clostridium acetobutylicum ATCC 824]
------------------------------------------------------------
------------------------------------------------------------
---------MNNKKSTNVVWQETKIKRQNREKMLKQKGAVLWFTGLSGSGKSTVASALEK
KLYEM-GYLTYLLDGDNLRYGLNS-----------------DLGFKSEDRTENIRRVSEV
AKLFADAGIITITTFISPFIEDRNNARKLLGK----DFVEVYIDCPIEVCEKRDPKGIYK
KARNGEIKNFTGIDSPYEKPEKPEITVETYK-----DTEEKCVDNIIEYLKQHKIL----
------------------------------
>gi|127512354|ref|YP_001093551.1|	   209 residues, 50 /line  Adenylyl-sulfate kinase [Shewanella loihica PV-4]
--------------------MSP-------------------------------------
------------------------------------------------------------
-----YKTVDVNVKSSDVQWHQASVTHAEREQANGHKGAVLWFTGLSGSGKSTVANAVDR
LLHDR-GCNTYVLDGDNVRHGLNG-----------------DLGFSDEDRVENIRRIGEV
AKLFVDAGTLVSTAFISPFNADRKLVRDLLAA-H--QFIEVFIDTPLEVCEQRDPKGLYK
KARAGEIKHFTGIDSAYEAPVSPEVHVKSAE-----QSVQQCAEQVVDYLVKQGLLA---
------------------------------
>gi|86147233|ref|ZP_01065548.1|	   215 residues, 50 /line  adenylylsulfate kinase [Vibrio sp. MED222]
-------------------MTTP-------------------------------------
------------------------------------------------------------
-----YQRKNNDSVSDDVVWHNSTVTHQDRVAQKGQNPVILWFTGLSGSGKSTVANAVES
KLLQM-GKHSYLLDGDNVRHGLNQ-----------------DLGFSDSDRIENIRRIGEV
AKLFVDAGNIVLTAFISPFISDRQQVRELVTE-G--EFLEVFVDTPLEVCEARDPKGLYK
KARAGEIKHFTGIDSEYQAPVNPEIHLHTAE-----LSIEACADFVVAELEKKGYLQLGG
Q----------------------------Y
>gi|71278772|ref|YP_268870.1|	   209 residues, 50 /line  adenylylsulfate kinase [Colwellia psychrerythraea 34H]
------------------------------------------------------------
------------------------------------------------------------
-------MTTTNMKTENTVWHNQQISKEQRATLKQQKPALLWYTGLSGSGKSTVANAVDA
LLFKL-GCHSYLLDGDNVRHGLNG-----------------DLGFSDEARIENIRRISEV
AKLFLDAGLIVSTAFISPFASDRALAKAKLED-G--EFIEVFIDTPISVCEQRDPKGLYK
KARAGEIKDFTGIDSTYDVPTAPQIHVKTAE-----QSVEQCAEQIVSHLIEQGFISEMT
L----------------------------S
>gi|126652065|ref|ZP_01724254.1|	   197 residues, 50 /line  adenylylsulfate kinase [Bacillus sp. B14905]
------------------------------------------------------------
------------------------------------------------------------
-------------MSSNIVWHEASVTKEERRSQNKHQSFILWFTGLSASGKSSIANAFAR
QLYER-GNQAFVLDGDNVRHGLNK-----------------DLGFEEAGRKENIRRIGEV
SKLFIESGQIVLTAFISPYREDRQVVRALVED-G--EFIEVFVKCSVETCEKRDPKGLYK
KARKAEIANFTGVSAPYEEPENPEIILDTEH-----HTIEECVQQLTSILTSKGYI----
------------------------------
>gi|56962388|ref|YP_174114.1|	   202 residues, 50 /line  adenylylsulfate kinase [Bacillus clausii KSM-K16]
------------------------------------------------------------
------------------------------------------------------------
----------MTKTNSNLVWHEASVSKQERHARHNHKGCVLWFTGLSGSGKSTLANALDR
SLFDA-GLSTYVLDGDNIRHGLNK-----------------DLGFSDRDRQENIRRIGEV
AKLFVDAGTIVSTAFISPFQSDRDQARALLAD-G--EFVEVYVKCPLEECERRDVKGLYK
KARNGEIPQFTGISSPYEEPETPEITVDTSV-----QTVEESVEQIIGWLEKHHILTR--
------------------------------
>gi|16078155|ref|NP_388972.1|	   199 residues, 50 /line  hypothetical protein BSU10910 [Bacillus subtilis subsp. subtilis str. 168]
------------------------------------------------------------
------------------------------------------------------------
-----------MTHNPNIIWHPAAISKSDRQSLNGHKSCVLWFTGLSGSGKSVLANAVDE
KLYRK-GIQSYVLDGDNIRHGLNK-----------------DLGFQTGDRIENIRRIGEV
AKLFVDSGQMILTAFISPFREDRDMVRALFPK-G--EFFEIYVKCPLHVCEQRDPKGLYK
KARNGEIKHFTGIDSPYEAPLSPDFIIESDQ-----TSISDGADLIINALQNRGII----
------------------------------
>gi|83645513|ref|YP_433948.1|	   207 residues, 50 /line  Adenylylsulfate kinase and related kinase [Hahella chejuensis KCTC 2396]
------------------------------------------------------------
------------------------------------------------------------
------------MVDANIVWQDFKLQRQDRAQIKGQKPCLIWFTGLSGSGKSTLSNALDI
ELHKR-HYHTYVLDGDNIRHGLNK-----------------DLSFSDSDRIENIRRVAEA
SKLLVDAGIIVMTAFISPFKADREMVKALFGE-G--EFTEVFVNTPLHICEQRDPKGLYQ
KARRGDIKNFTGIDSPYEPPESPDIMVDTSN-----ETTEESIAKIISYLEERKIINPLR
NLE-------------------------DE
>gi|149925705|ref|ZP_01913969.1|	   302 residues, 50 /line  bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein [Limnobacter sp. MED105]
MLNNQFEGEILWASATPMIVGRAYQAEINNTIKAQCTITELKYVL--ASDGETRLAAKTL
AA-------------------------GQRAVVNLQLEPGIEPKCDVTQVALELIDPDDD
NASSTCNLHFALRRSSNIRWQAMAIDRAARENLMQQKGKCIWFTGLSGSGKSTIASAFEQ
HLYRQ-GMFTMTLDGDNVRHGLNK-----------------DLGFTETDRVENIRRVAEV
SKLMVEAGLVVLVSFISPFRAERKLARDLFAP-G--DFIEVFVDTPLEECERRDVKGLYA
KARRGEIKNFTGIDSAYEAPLNPEMRLPTVE-----MKIEDCCLALVEKLNEVPK-----
------------------------------
>gi|90419546|ref|ZP_01227456.1|	   208 residues, 50 /line  adenylylsulfate kinase apsK [Aurantimonas sp. SI85-9A1]
------------------------------------------------------------
------------------------------------------------------------
------MAETERSHAPNVRWQTFDLDKQRRATAMGQKPAVIWFTGLSGAGKSTIANLVEK
SLFAR-GRHTYLLDGDNLRHGLNR-----------------DLGFSEADRVENIRRVAEA
ARLFVDAGLIVLASFISPYRSDRRMARSLFED-G--EFIEVFVDTPLEIAEQRDPKGLYK
RARAGLIKDFTGIDSPYEAPEQAEIRLEAGT-----QEPDVLANQIMRYLCRGQYFEPMS
------------------------------
>gi|77962832|ref|ZP_00826648.1|	   206 residues, 50 /line  COG0529: Adenylylsulfate kinase and related kinases [Yersinia mollaretii ATCC 43969]
------------------------------------------------------------
------------------------------------------------------------
-----MLTDQVTPADDNIVWHPHAVTRQDREQQHGHQGVVLWFTGLSGSGKSTVAGALEQ
ALFAR-GVSTYLLDGDNVRHGLCR-----------------DLGFSDEDRRENIRRVGEV
AKLMVDAGLVVLTAFISPHRAERKMVRDMLAT-G--QFIEVFVDTPLAICEARDPKGLYK
KARAGELKNFTGIDSIYESPEHADIHLQG-E-----QLVTNLIEQLLDVLRGSAIIKS--
------------------------------
>gi|78213928|ref|YP_382707.1|	   214 residues, 50 /line  adenylylsulfate kinase [Synechococcus sp. CC9605]
------------------------------------------------------------
-----------------------------------------------------------M
TASPTYGELTNKGASTNIAWHEASVGRDERSKQRGHRSAILWFTGLSGSGKSTLANAVNA
ALFER-GLATYVLDGDNIRHGLCK-----------------DLGFSDADREENIRRIGEV
AKLFLDAGVIVLTAFVSPFRADRDKARGLVED-G--DFLEVFCAADLEVCESRDPKGLYA
KARAGQIKEFTGISSPYEAPETPELKIDTGK-----QDLADSVELVIKALQERGVIPAA-
------------------------------
>gi|88799797|ref|ZP_01115371.1|	   200 residues, 50 /line  Adenylylsulfate kinase and related kinase [Reinekea sp. MED297]
------------------------------------------------------------
------------------------------------------------------------
-------------MLNAVQWHHHQVSRDDRAAQKSQKPCVLWFTGLSGAGKSTLANLVEQ
NLFAH-GYHSFLLDGDNVRHGLNK-----------------DLGFSDADRVENIRRIGEV
AKLMTDSGLIVLSAFISPFERDRALVRDLFAD-H--EFLEVYVDAPLDVCERRDPKGLYK
RARAGQIRDFTGIDSEYQPPSHPDIHIRTDN-----LSSTQCAERVVQYLKLRGYLKDR-
------------------------------
>gi|90581322|ref|ZP_01237118.1|	   207 residues, 50 /line  adenylylsulfate kinase [Vibrio angustum S14]
------------------------------------------------------------
------------------------------------------------------------
----MTITPQAHDDNENIVWHRHTVTKELRATQKNQKASVLWFTGLSGAGKSTVAGALEN
KLAEM-GYHTYLLDGDNVRHGLCR-----------------DLGFSAEDRRENIRRIGEV
ATLMADAGLIVLSAFISPHREERQLVRDLLPE-G--EFIEVFVDTPLAECEKRDPKGLYK
KARAGEIKQFTGIDSEYQPPLSPELHLAAGS-----NAIDKLVAQCVEHLKSQQIIS---
------------------------------
>gi|149176643|ref|ZP_01855255.1|	   204 residues, 50 /line  adenylylsulfate kinase [Planctomyces maris DSM 8797]
------------------------------------------------------------
------------------------------------------------------------
---------MAEQKATNVTWHDHRVTKEERCKQNGHKGAVLWFTGLSGSGKSTIANTVDH
KLFEM-GKHTFVLDGDNIRMGLNK-----------------NLGFSPEDRTENIRRIGEV
SKLYTDAGILVMTAFISPYLEDRDQVREIMGE-G--EFIEVLVKASLETCEERDPKGLYK
KARAGEIKGFTGIDAPYEAPEKPELVLDSDA-----KGIDELADEVVAYLEANGYLTYA-
------------------------------
>gi|149376785|ref|ZP_01894542.1|	   206 residues, 50 /line  Adenylylsulfate kinase and related kinase [Marinobacter algicola DG893]
------------------------------------------------------------
------------------------------------------------------------
-------------MSENIVWHHQKVTRADRASIKNQSPCLLWFTGLSGSGKSTIANALDV
ALFER-GYHTFLLDGDNVRHGLNR-----------------DLGFSDEDRVENIRRIGEV
SKLFTDSGVIVLSAFISPFTSDRRLVRNLFPA-G--EFVEVFMDTPLQTCEDRDPKGLYE
KARAGKIKHFTGIDSPYESPERPEVRLDTSQ-----MSVDDCVNRLISYLLDRQLIFTSP
Q-------------------------ANGA
>gi|83648802|ref|YP_437237.1|	   220 residues, 50 /line  Adenylylsulfate kinase and related kinase [Hahella chejuensis KCTC 2396]
-------------------MAKE-------------------------------------
------------------------------------------------------------
-----YTIKSGNDVCADIVWHQHKISKSQRASIKTQKPCLLWFTGLSGAGKSTIANAVEA
QLFEW-RRHTYLLDGDNVRYGLNK-----------------DLGFSDESRVENIRRIGEV
AKLFVDSGMIVLSAFISPFREDRKIVRQMLEP-G--EFVEVHVSTPLNVCEQRDPKGLYK
KARAGRIEKFTGVDSPYEPPVNPELTLNTDA-----LSLSECVERVIGYLIAQQFIVERD
ATL-----------------------YRAS
>gi|116508383|gb|EAU91278.1|	   200 residues, 50 /line  hypothetical protein CC1G_11536 [Coprinopsis cinerea okayama7#130]
------------------------------------------------------------
------------------------------------------------------------
-------------MSTNITFHAGSVTREERDALLKQKGVTIWLTGLSASGKSTIACALEQ
HLLHL-HKFAYRLDGDNIRFGLNK-----------------DLGFDEKSRNENIRRIGEV
AKLFSDASAITITAFISPYRQDRAVARELHDK-AGIPFVEVFVDAPLSVVEERDPKGLYK
KARAGEIKDFTGISAPYEAPESPELHIKTDQ-----TSVTQAVEQITNYLQSKGYLN---
------------------------------
>gi|116749767|ref|YP_846454.1|	   227 residues, 50 /line  Adenylyl-sulfate kinase [Syntrophobacter fumaroxidans MPOB]
------------------------------------------------------------
------------------------------------------------------------
---------MTEVKATNITWHSSQVTRNEREALLNQRGCTIWLTGLPSSGKSTTAFALEY
ELIQR-GYMTYVLDGDNIRHGLNK-----------------NLGFSAQDREENIRRIGEV
AKLFADSGIIVVTSFISPYQRERDLARKIHEE-AGLGFFEIHVSTPVVVCEERDPKSLYK
KARRGELKGFTGVDDPYEAPPNPELIVDASN-----NSPEDLVTQILPLLEEKQYIGAGF
KAYRQ----------QFSAARKTVIQRGTA
>gi|118497518|ref|YP_898568.1|	   200 residues, 50 /line  adenylylsulfate kinase [Francisella tularensis subsp. novicida U112]
------------------------------------------------------------
------------------------------------------------------------
-------------MSDNIIWHKTSVSTEERSLQKKHKPIVLWYTGLSGAGKSTIANAVDR
ILYER-GYHTYIIDGDNIRHGLNH-----------------DLGFDEISRTENIRRVSEV
AKLFVDAGLIVSIVLISPFIYDREQARKIIGD----NFIEIFIDAPLAECEKRDPKKLYK
KAREGEIANFTGISSPYEKPINPDIHITSSS-----KTIDECADKIINYLLDKNILNKV-
-----------------------------V
>gi|118734142|ref|ZP_01582649.1|	   228 residues, 50 /line  Adenylyl-sulfate kinase [Delftia acidovorans SPH-1]
------------------------------------------------------------
------------------------------------------------------------
------MLFSGQNPPPDIHDQLSSVSRQDREILHGHKAVAIWLTGLSGSGKSTIANALQA
HLHAA-GRRTYVLDGDNIRSRLNR-----------------DLGFSEEDRAENIRRVSEV
ARLFVDAGTIVIAAFISPFRSERDTARALFDK-G--DFLEVFVDVPLSVAERRDPKGLYR
KARRGELRQFTGIDSPYEPPVAAELTLRTDQ-----LSVAACVSRLQALLLQGQPTAPGT
PAQGM----------APLMTCPLPLAKALQ
>gi|119477700|ref|ZP_01617850.1|	   205 residues, 50 /line  adenylylsulfate kinase [marine gamma proteobacterium HTCC2143]
------------------------------------------------------------
------------------------------------------------------------
---------MTEQKATNVHWHDGEVTREDRSKILSQKGATLWFTGLSGSGKSTVAVALEQ
ALTAK-GKLTYRLDGDNIRLGINK-----------------NLGFSAEDRTENIRRIGEI
SKLFVDVGVITLSSFVSPYRADRDLVRELHKQ-AGMDFIEVYVDVPLDVAEDRDPKGLYK
KARAGEIPNFTGISDPYEEPLNAEVVLNSHE-----MTLEQEVDILLQIMTDRGLLAA--
------------------------------
>gi|121542501|ref|ZP_01674227.1|	   204 residues, 50 /line  Adenylyl-sulfate kinase [Candidatus Desulfococcus oleovorans Hxd3]
------------------------------------------------------------
------------------------------------------------------------
---------MTNHEKANIYWHQGQIRKADRERLSGHRGAVLWLTGLPASGKSTVAVALEK
KLFDR-GCRTYILDGDNIRHGLNR-----------------DLGFSPEDRTENIRRIGEV
ARLFCDCGVLTMVAFISPYQSDRQAAREAAEEPG--TFIEVFVDCPLATCEQRDPKGMYR
RARAGEIQGFTGISAPYEVPEKPEIYLDTGI-----NDLSACVDTVIRYLEMNGFIPA--
------------------------------
>gi|124484351|dbj|BAF46286.1|	   247 residues, 50 /line  adenylylsulfate kinase, chloroplast [Chlamydomonas reinhardtii]
------------MQSAPSLL-----------SRFGCLVRPANFAA--A------------
-----------------------------------------------------------S
VASRAMSTAYDVGSSTNIKWHEGAVPTENKEAIMQQKGCVVWFTGLSGSGKSTVACTLEH
ALAES-GKVTALLDGDNIRHGLNS-----------------NLGFSATDREENIRRIGEV
SKLFADTGIVTLVSFISPYRRDRDRVRSRVPE-G--RFIEVFMKVPISICEERDPKGLYK
KARAGQLKGFTGIDDPYEEPLNAKVVLEAETADGKRISPQDQARTLLEYLHSKGFLTGPS
TPP--------------------------K
>gi|145350848|ref|XP_001419808.1|	   219 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
-----------------------------------------------M------------
-----------------------------------------------------------T
HARARAVDAYKVGESTNIKWHEGAVDRETRERALGQRGCVLWFTGLSGSGKSTVAYTLEH
ELFKR-GKIAQVLDGDNIRHGLNS-----------------NLGFTAADREENIRRIGEV
SKLYADSGMITLVSFISPYKKDRLAVRERVGD----RFVEVYMKIPLSVCEERDPKGLYK
AARAGKIKGFTGIDDPYEEPVNAEIEMEVAKEDGVLAPPRDMAHKIIEYLDAKGFLKAD-
------------------------------
>gi|147676573|ref|YP_001210788.1|	   208 residues, 50 /line  adenylylsulfate kinase and related kinases [Pelotomaculum thermopropionicum SI]
------------------------------------------------------------
------------------------------------------------------------
---------MAVQKASNIVWHEGSVSKKDRERFLGQKGVVVWFTGLSGSGKSTVAREVEA
RLLKL-GCLSYVLDGDNIRFGLNN-----------------NLGFSPEDRAENIRRVSHV
ARLFADAGIITLTAFISPYRADREAARALLGP-G--EFIEIYVRCSLEECEKRDAKGLYK
KARAGEIKEFTGISAPYEEPLSPELVLETER-----ETPQESAEKVIRFLADRGIISKGV
CR---------------------------H
>gi|23099116|ref|NP_692582.1|	   199 residues, 50 /line  adenylylsulfate kinase [Oceanobacillus iheyensis HTE831]
------------------------------------------------------------
------------------------------------------------------------
-----------MNKSTNIVWQKTSVKKADRQHLNNHKSAVLWFTGLSGSGKSTLSSALEK
ELFSL-ETHTYHLDGDNVRHGLNK-----------------NLGFSPEDREENIRRIGEV
SKLMVDAGLITLTAFISPYQEDRDHVRATLAQ-D--EFIEIYVKCSLDMCEARDPKGLYK
KARLGEINNFTGIDAPYEEPLHPEIVIDTE-----NQSIEESVQTIIHYLKDKQYI----
------------------------------
>gi|33150442|gb|AAP97123.1|	   233 residues, 50 /line  adenosine 5'-phosphosulfate kinase [Porphyra purpurea]
------------------------------------------------------------
------------------------------------------------------------
-------------MSTNVVWHEGLITREARAKLLGQKGATVWLSGLSGSGKSTVSVELEQ
QLFAK-KVLSYRLDGDNIRQGLNK-----------------NLSFSPADRKENIRRISEV
AKLMCDIGVVVTTAFISPYTEDRDMAREIHKA-ASIPFIEVFVDCPLEVAESRDPKGLYK
KARSGEIKNFTGIDAPYEKPPSPEITLDTS-----KQTIAECAAVILTYLTEKGLISSEP
KEEAKPAKELEVAPAAPAAEAEAEKVPAAV
>gi|3329471|gb|AAC26856.1|	   271 residues, 50 /line  5'-adenylylsulfate kinase [Enteromorpha intestinalis]
----------MLRAIAQRARGSALQCAAPGT-----------------------------
-------------------------------------------------------EWASC
VRGSSGFTAYDVGESTNIKWHETMVSRGDKERLLNQRGCVLWFTGLSGSGKSTVACTLEH
ALNAR-GKMTALLDGDNVRHGLNS-----------------NLTFTAEDRTEHPPHRRSE
QALCRRWRPPLRELHLRPIAPTRPV-RERC-A-G--DFVECYMKIPIELCEQRDPKGLYK
KARAGLMKGFTGIDDPYEEPLEPELTITVREEGSDMNSPEAMAKQIFDYLEAKGFLKGPA
VAS-SGGSCARVARWGGHGRRRGRQRLA-W
>gi|41408697|ref|NP_961533.1|	   230 residues, 50 /line  hypothetical protein MAP2599c [Mycobacterium avium subsp. paratuberculosis K-10]
------------------------------------------------------------
------------------------------------------------------------
-------------MSNNITWHEHKISRGEREQLNGHKGCVIWFTGLSGSGKSTVANVVEQ
KLYER-GIRSYLLDGDNVRYGLNAGPDLLEERHGPEFAQRFGLGFSAQDREENIRRIGAV
AKLFCEAGIIALTAFISPYVRDRDAIRATLDD-G--DFQEIFIDTPIEICEKRDPKGLYK
KARAGEIKGFTGIDDPYEAPPRPELRLDGA-----AKDAETLAEEVIAHLERVGVIATDG
LAH-T----------------RGRDEVT-A
>gi|53801440|gb|AAU93922.1|	   208 residues, 50 /line  plastid adenylylsulfate kinase [Helicosporidium sp. ex Simulium jonesii]
-----MQCASLFRYKTPVIQANSVSCNAPPS--------------------------LVH
MP-------------------------R-------------------PRPASSRVRLAPL
SANAKPLETRTVGNSTNIRWHKASVAREDKERLLGQRGCVLWFTGLSASGKSTVATETER
QLHER-GHLTLLLDGDNVRHGLNC-----------------NLGFSAEDRTENIRRVGEV
AKLVAESGVMALTSFISPYREDRDAVRERVGS-G--SFLEVFLAVPIELCEERDPKGLYK
KARC--------------------------------------------------------
------------------------------
>gi|53803501|ref|YP_114624.1|	   203 residues, 50 /line  adenylylsulfate kinase [Methylococcus capsulatus str. Bath]
------------------------------------------------------------
------------------------------------------------------------
-------------MNTHIVWHQSTVTRGQRERQNGHKSFILWFTGLSGAGKSTLAHRVEQ
LLFEQ-GCRTYVFDGDNVRHGLCS-----------------DLGFSAEDRCENIRRIGEM
SKLFVDAGVIALTAFISPFRRDRDLVRALVEP-G--DFVEIFCDAPLEVCEQRDVKGLYR
KARAGEIPEFTGISSPYEKPLAPEITVRTG-----EDGLDECAGQILGYLEKNGKINLKT
T----------------------------R
>gi|78044915|ref|YP_361478.1|	   197 residues, 50 /line  adenylylsulfate kinase [Carboxydothermus hydrogenoformans Z-2901]
------------------------------------------------------------
------------------------------------------------------------
-------------MANNLFWHEGKITAEDREKLLGQKGVVIWLTGLSGSGKSTIARELEA
VLYRQ-GKLAYVLDGDNIRMGLNK-----------------DLGFSEKDRQENIRRIGEV
AKLFVDAGIIVITAFISPFRADRDKVRSILPA-G--KFIEVFVDCPLEVCEARDVKGLYQ
KAREGKIPEFTGITSPYEPPVKPEITLKTA-----EQSLEECVDIILTYLRKNLYL----
------------------------------
>gi|78778554|ref|YP_396666.1|	   211 residues, 50 /line  adenylylsulfate kinase [Prochlorococcus marinus str. MIT 9312]
------------------------------------------------------------
------------------------------------------------------------
--MMQKMKEQDQTNSTNIKWHNLTIDRDKLEKMRGHKGMVIWFTGLSGSGKSTLANALNE
VLHLD-GFSTYVLDGDNIRHGLCR-----------------DLGFSDEDREENIRRIGEV
ANLFMNAGIITITAFVSPFISDRDKVRKIIGS-K--DFIEVYCAADIKVCENRDTKGLYK
KARLGEIKDFTGISSPYEAPHNPEIIVDTG-----SLDLKDSVEKVINYLKKENFLKKG-
------------------------------
>gi|89096415|ref|ZP_01169308.1|	   200 residues, 50 /line  adenylylsulfate kinase [Bacillus sp. NRRL B-14911]
------------------------------------------------------------
------------------------------------------------------------
-----------MAHSLNLTWHEAAVTKEERRAQNGHASCVLWLTGLSGSGKSTIANIVSH
RLFKD-GIDEYVLDGDNIRHGLNR-----------------DLGFSEEDRNENIRRIGEV
AKLFTDSGQIVCTAFISPYRKDRELVRSLFPEKG--EFIEVFIDCPLEECEKRDPKQLYQ
KARREEIKGFTGIDAPYEEPEDPEIIIRTD-----QLSPEEAAEKILIYLKEQGII----
------------------------------
>gi|89098341|ref|ZP_01171225.1|	   212 residues, 50 /line  adenylylsulfate kinase [Bacillus sp. NRRL B-14911]
------------------------------------------------------------
------------------------------------------------------------
----MALERSVPLKEKHITWHCSAITKSLRQKQNEHKSAVLWFTGLSGSGKSTIANAVQA
MLFKR-GIQAYLLDGDNLRHGING-----------------NLSFSQEDRKENIRRTAEM
AKLFSDAGFVVLASLISPYKADRKMARELMDE-G--EFIEIYIDCPVEECEKRDPKGLYK
KVRNGEIKGFTGIDDPYEKPEKPEIILHTG-----KHSLEECVQSVMKYLDDVYELKTFK
E----------------------------E
>gi|90021781|ref|YP_527608.1|	   199 residues, 50 /line  Flagellar biosynthetic protein FlhB [Saccharophagus degradans 2-40]
------------------------------------------------------------
------------------------------------------------------------
---------------MDIVWHDHKITKEVRQEQHGHKSCVIWFTGLSGSGKSSVASELER
ALVQQFNAKTYLLDGDNVRHGLCK-----------------DLGFTADDRVENIRRVGEI
SKLFVDAGLITLSAFISPFRTERRLARELLED-G--EFIEVFVDTPLSECEKRDPKGLYQ
KAREGKIKNFTGIDSKYETPENPEIHLENG-----KQTIQESVEQIITYLKKHNYLASL-
------------------------------
>gi|91202486|emb|CAJ72125.1|	   203 residues, 50 /line  strongly similar to adenylylsulfate (adenosine 5'-phosphosulfate) kinase [Candidatus Kuenenia stuttgartiensis]
------------------------------------------------------------
------------------------------------------------------------
---------MSDQKATNIKWHHGKITKAHRIDLMKQKGVTIWLTGLSGSGKSTIAVELEH
ALVEN-KHQAYILDGDNIRHGLNK-----------------NLGFSPEDRAENIRRIGEV
AKLFTDANIITITAFISPYKEDRDNARKLQNE-G--EFIEIYVKCPLNVCEQRDVKGLYK
KARTGEIKEFTGISAPYEEPSNPELTIDTS-----VMPVEESTRAILKYLEENRYVR-F-
------------------------------
>gi|15236087|ref|NP_195704.1|	   293 residues, 50 /line  AKN2 (APS-KINASE 2); ATP binding / kinase/ transferase, transferring phosphorus-containing groups [Arabidopsis thaliana]
MEG--LAIRASRPSVFCSIPGLG-GDSHRKPPSDGFLKLPA----SSIPADSRKLVANS-
--------TSFHP-ISAVNVSAQASLTADFPA--------------------------LS
ETILKEGRNNGKEKAENIVWHESSICRCDRQQLLQQKGCVVWITGLSGSGKSTVACALSK
ALFER-GKLTYTLDGDNVRHGLNR-----------------DLTFKAEHRTENIRRIGEV
AKLFADVGVICIASLISPYRRDRDACRSLLPD-G--DFVEVFMDVPLHVCESRDPKGLYK
LARAGKIKGFTGIDDPYEAPVNCEVVLKHTGD-DESCSPRQMAENIISYLQNKGYLEG--
------------------------------
>gi|7387809|sp|O49204|KAPS_CATRO	   312 residues, 50 /line  Adenylyl-sulfate kinase, chloroplast precursor (APS kinase) (Adenosine-5'-phosphosulfate kinase) (ATP adenosine-5'-phosphosulfate 3'-phosphotransferase)
-----MIGSVKRPVVSCVLPEFDFTESTGLGKKSSSVKLPV----NFGAFGSGGGEVKL-
--------GFLAP-IKATEGSKTSSFQVNGKVDNFRHLQPS--DCNSNS--DSSLNNCNG
FPGKKILQTTTVGNSTNILWHKCAVEKSERQEPLQQRGCVIWITGLSGSGKSTLACALSR
GLHAK-GKLTYILDGDNVRHGLNS-----------------DLSFKAEDRAENIRRIGEV
AKLFADAGVICIASLISPYRKPPDACRSLLPE-G--DFIEVFMDVPLKVCEARDPKGLYK
LARAGKIKGFTGIDDPYEPPLKSEIVLHQKL--GMCDSPCDLADIVISYLEENGYLKA--
------------------------------
>gi|9757873|dbj|BAB08460.1|	   290 residues, 50 /line  adenylylsulfate kinase-like protein [Arabidopsis thaliana]
-----MARCVGRCYV---SPAFG-ESESHRLSERRFLKLSS----STNSDPAGSKSLKLR
GKIHR-RMSYFRP-IMAKDESISSR-----------------------------------
----SGETKQINGKQKNIVWHDCPVTKSDRQELIKQKGCVIWITGLSGSGKSSLACALSR
ALHNR-GKLSYILDGDNVRHGLNS-----------------DLSFEADDRAENIRRVGEV
AKLFADSGIICIASLISPYRIERAACRALLPQ-G--DFIEVFMDVPLHVCEARDPKGLYK
RARAGKIKGFTGVDDPYEAPLDCEVHIISNF--SSSSSLCEMADIVVSYLDQNGYLKKHS
TKSR-----------------------NCM
>gi|92866969|gb|ABE77442.1|	   264 residues, 50 /line  Adenylylsulfate kinase; AAA ATPase [Medicago truncatula]
--M--CFVQALQPQCGGVTFQNI-ECGTSTVEKLGIVNFRHRFNAVELRRCR--------
-------KSMLKP-IMAQDERESSIADDDNRIPKYKGISVNKRNCVKNEPDSSFIDHSAA
FSGKNLSNLTTNGNSTNILWHECSIQKLDRQQLLQQKGCVVWVTGLSGSGKSTLACALSR
SLHSR-GKLTYILDGDNIRHGLNR-----------------DLSFRAEDRSENIRRIGEV
AKLLADAGVICITSLISPYQKDRDACRALLPK-G--DFIEVHILIEVNAGSLSSVN----
------------------------------------------------ATIANTMIRS--
------------------------------
>gi|92880848|gb|ABE85872.1|	   306 residues, 50 /line  Adenylylsulfate kinase [Medicago truncatula]
--M--TTVKSLPPSRSTAVYRTV-QCRQLPTENLG---FPTLFPLNAGRSCRSQRSLALF
YDRARLKAYTLKP-IQAKNDSESSCSDNNS-------------------TSFSAVNETGN
-LVKISARCQILGNSTNILWHDCPVQKCDRQQLLQQKGCVIWLTGLSGSGKSTLACALSQ
SLHSR-GKLTYILDGDNIRHGLNR-----------------DLSFRAEDRSENIRRIGEV
AKLFADAGLICITSLISPYQKDRDACRALLPE-G--DFIEVFIDVPLHVCEARDPKGLYK
LARAGKIKGFTGIDDPYEPPCCCEIILQQKG--SDCKSPKDMAETVISYLEKSGHLQA--
------------------------------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.