Fandom

Proteins Wiki

At2g14340.1/MSA

< At2g14340.1

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|15225644|ref|NP_179042.1|	   220 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------M--------DHR
QSIQRVRTSAP---SSPASL----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------TPTSPDCSSPPAPE-WLVDI--------------------
-------------GIIRQHLGVPLH----------------------------------R
VIPHGAVEPTVP------------------WMWSPLPGDM---GSDFVPAPRDFIPGEVI
WPGKFFGQTNLSDEMHDACQMFIQKVDNQHQAYRRHHRQLLI-------KLQDLERGMRR
LEAHPKDWVRYDFDKVADIPLPLRRWCVEHDGSSPNY---VCFAEPILI-EEDD------
------------------------------------------------------------
--------------------------------------------------EPDDG-----
------------------------SYYWRVDEPPREY--------------------PPD
SLFQ----------
>gi|10177795|dbj|BAB11286.1|	   181 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
------------------------------------------------------------
---------------------------------------------MSGSQVSRGTSS---
-------------------------------------------------------DSDDE
LDSSSTSIRGYFGC----------------------------------------------
------------------------------------------------------------
------------------------PRRDRSPSPI-CVVED--------------------
-------------RVIRRP-----------------------------------------
ALPVG--EPLYP------------------WRRPPLIA----ASPSFTPVGRDFVPGSVK
YPADLL--RHLHPEEAARFRYWFRTLEGQHRAYCRRHAELLR-------MMQEMELGMRR
LEADPKDWERFGLGKLNPLPPFLRAYCRAK------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------LHEDEASSSR--------------------GP-
--------------
>gi|15222542|ref|NP_174480.1|	   181 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
---------------------------------------------MSGSQVSRGTSS---
-------------------------------------------------------DSDDE
PDSSSTSNRGYFGC----------------------------------------------
------------------------------------------------------------
------------------------PRRDRSPSPI-RVVED--------------------
-------------RVIRRP-----------------------------------------
ALPVG--EPLYP------------------WRRPPVIA----ASPSFTPVGRDFVPGSVK
YPADLL--RHLHPEEAARFRYWFRTLEGQLRAYCRRHAKLLR-------MMQEMELGMRR
LEADPKDWERFGLGKLNPLPPFLRAYCRAK------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------LREDEASSSR--------------------GP-
--------------
>gi|116831341|gb|ABK28623.1|	   210 residues, 50 /line  unknown [Arabidopsis thaliana]
------------------------------------------------------------
-------MSAP---SSPASL----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------TPTSPDCSSPPPPE-WLVDI--------------------
-------------GMIRLELGVPLH----------------------------------R
VIPPGAVEPTVP------------------WMRSPLPGYM---GPDFVPAPRDFVPSEVI
WPEKFFGQTNLFPEMHEACQMFIQKVDNQHQAYRRRHRQLLI-------KLQDLERGMRR
LEAHPKDWVRYGFDKVADIPLPLRRWCVEHDGSSPNY---ACFAEPIPI-KEDD------
------------------------------------------------------------
--------------------------------------------------EPDDG-----
------------------------SYYRRVDEPPREY--------------------PPD
SLFQ---------G
>gi|22331483|ref|NP_683635.1|	   154 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------MKSPLPGDM---GPDFVPAPRDFVPGEVI
WPGKFFGQTNLSNEMHDACQMFIQKVDNQHQAYRRRHRQLLI-------KLQDLERGMRR
LEAHPKDWVRYGFDKVADIPLPLRRWCVEHDGSSPNW---SFFAEPNPI-EEDD------
------------------------------------------------------------
--------------------------------------------------EPDDG-----
------------------------SYYWRVDEPPREY--------------------PPD
SLFQ----------
>gi|15233858|ref|NP_192678.1|	   513 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----MDGYHSVSELCPT-ISGWTICVFVVTVFKKFVAPDEFKLGLILA--------DQT
GPRSRIKATIP---RRLASFYFDRIREYE-----YEWIIITNFSVRNDAESVRATSHDYQ
IW--------------FMEQTIVTKALRTDALSFYNFTPFDNIIEKTVNKNVLVEDGGDS
LAATSIFRRQDFSGKRRHFFTSEKSDGFDYYNAIRDGNWGIPTKCYGGRDVEKGNVVGGN
HHGKTRFRCPL-----NLTEVDGEHLHKWWEEATEEKFS---------------------
-------------------KYCSRKDKREEGPPA-WQVPMFEPIHEKIRIMNDRITELET
QLFKELRSIRTAISILRARGGRDLFWFYTGKRSSGIVLTLGCEDR---------HICSTR
TFHRKTTAPSTPDDIDTELELIGVRI----QEIELFPGELHGSSPEHSVTPRDFVPSEVI
WPEKFFGQTNLFPEMHEACQMFIQKVDNQHQAYRRRHRQLLI-------KLQDLERGMRR
LEAHPKDWVRYGFDKVADIPLPLRRWCVEHDGSSPNY---ACFAEPIPI-KEDD------
------------------------------------------------------------
--------------------------------------------------EPDDG-----
------------------------SYYRRVDEPPREY--------------------PPD
SLFQ----------
>gi|15230689|ref|NP_190123.1|	   224 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------------------------------------------MESP--------DHR
QTIQRVRTSAP---SSLASA----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------TPTSPDCSSPPPPE-WLVDI--------------------
-------------GFIRRHLGVPLH----------------------------------R
VIPLGEVEPTVP------------------WMRSPLPGDM---GPDFVPAPRDFVPGQVI
HPGKFFGQTNLSNEMHDTCLRFIQKVDNQHQAYRRRHRQLLI-------KLQDLERGMRR
LEVHPKDWVRYGFDKVADIPLPLRKWCVEHDGSSPNW---SFFTEPDPI-EEDD------
------------------------------------------------------------
--------------------------------------------------EPDDAT----
------------------------SSYMRVDEPPREY--------------------PPD
SLFQ----------
>gi|15225081|ref|NP_178676.1|	   98 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
--MQRIEGVTP---NYSLS-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------CRTWREEMRR
MEAHPKDWVCYGFDKVADIPLPLRKWCVEYDGSSPYF---KPWPESSDS-TGDG------
------------------------------------------------------------
--------------------------------------------------GADD------
------------------------DFLWRVDDNPVKN--------------------PPD
TLFQ----------
>gi|145334193|ref|NP_001078477.1|	   130 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------MLRYYDE-------RRSDIARKMAM
LESHPRHWLKNGFQLLAPMPDVLLSYCEDCDRDAAAV---SKEKNPTII-ADGN------
------------------------------------------------------------
-----FIPRTPSLFYLGPA---------ATDADTTECQNFVNQVGFLHQDQCRELQYFRT
KKRSG-------------------------------------------------------
--LSSRRARNSDC-
>gi|15228769|ref|NP_191807.1|	   166 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MAM
LESHPRHWLKNGFHLLAPMPDVLLSYCEDCDRDAAAV---SKEKNPTIS-ADGN------
------------------------------------------------------------
-----FIPRTPSLFYLGPA---------LTDADTTECKNFVN------QDQCRELQYFRT
KKRIVDFRLEELETLIAKLK-KKRRVVTRLDEVEQTIRALEIRSEDWEKAGLQLVWPMPD
RLLQDNRIVSDRAI
>gi|22325405|ref|NP_671761.1|	   249 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----MESV---------------------------------------------------
---------------------------------------------GSSPFVGRN------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------IPTFSNAE-----------------------------
----------------AIERGMPFF----------------------------------N
NL-------RVP------------------WTL---------------------------
-------LFQASSEERREAEGFLSCVESRHKEYREMLRYYDE-------RRSDIARKMAM
LESHPRHWLKNGFQLLAPMPGILLSYCEDCDRDAAAV---SKEKHPTII-ADGD------
------------------------------------------------------------
-----FIPRTPSLFYLGPA---------ATDADTTECQNFVN------QDQCRELQYFRT
KKRRVDFRLEELETLIAKLKKKRRRVVTRLDEVEQTIRALEIRSEDWEKAGLQLVWPMPD
RLLQDNRTVSDRAI
>gi|11994530|dbj|BAB02594.1|	   450 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
MLAQVVKKSGNGLVEMPSLRTSHRAGWFQQSFLRYKLLLGYKLLHWFKFQVLSDNSHINA
HHSSR-----------TNSELNDMIQYYERLLLDREQDVMAWKDKSSSLESDLRSSTEVK
QKLEDQLENLSSKLMQSNGEL-QDQYQRYDKIQEELSNARGRLS-ESESNAYDLS-----
-------------------------------NQLSKLQAKKEVKGHGIEWIQGAIVFIQT
EKTRTELESDIKEYESNLLLLDQTHDEDFSEEQERSELK---AVLAEKRSRLAALPSSSF
NPQQFEEFFTESPPLSESGLDWTSP--SDPVEPEVPIMSVVTPEPVATPPEILPSTN---
------------------------------------TVTVVIEDDDGSESGIPTEQPVT-
DVTDETETQSWTQSILSQLRLNSRMENEGASTVCPLDP----GSPLF-LSGDGFEPVGVL
FPHAVF--HFPSKEKKEAYD-FMDKVVDKHRRLCDERQRLGLKN----------------
------------------------------------------------------------
-------ESEVDVKNEGSTSNPE------------------------------PAVKEPV
PE------PLP-------------------------------------------------
------------------------------------------------------------
--------------
>gi|15229228|ref|NP_189901.1|	   194 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------MIA------
---------------------------------E--------------------------
------------------------------------------------------------
----------------IYLDNTYKMERERACTVCPLDP----GSPLF-LSGDGFEPTGVL
FPNAFF--HFPSKDKKEAYD-FMDKVVDKHRRLYDERQRLGLKRQTLEARIARIERKIRA
MESDPFQWEWRNFDCVAKIPHMLRMYLRAR-GQVSGPVNAPVQVIPSDSEDSDDEEEDSN
PWKRVKNEPDVDVKNEASTSNPE------------------------------PAMQEPV
PE------PLP-------------------------------------------------
------------------------------------------------------------
--------------
>gi|15232048|ref|NP_189759.1|	   148 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------MENEGASTVCPLDP----GNPLF-LSGDGFEPASVL
FPHAVF--HFPLKDKKEAYD-FMDKVVDKYRRLCDERQRLGLKRQMLEARISCVERKVRS
MESDPFQWDWRNFDCAAKIPHMLRMYLRAR-GQVPCPVNAPVEVIPSDSEEDNDEEEDSN
P-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------
>gi|29648907|gb|AAO86828.1|	   132 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------MDKVVDKYRRLCDERQRLGLKRQTLETRIARIERKVRA
MENDHFQWEWRNFDCVAKIQHMLRMYLRAR-GQVPGTVKAPVKVIPSNSEDGDDEEEDSN
PWKRVKNEPDVDVKNEVSISNPE------------------------------PAMKDPV
PE------PLP-------------------------------------------------
------------------------------------------------------------
--------------
>gi|7267370|emb|CAB77931.1|	   263 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------MELIQGAIVFIQT
EKTRTELESDIKEYEINLLLLGQTHDEDFSEDQESDPVEPEVSIMPLETPTLVAIPTEIP
PPTN-----TETVVIEDDD--------------E--------------------------
------------------------------------------------------------
----------------IYLVNTSRKENERASTVCPLDP----VSPLF-LSGDGFEPASVL
FPHAVF--HFPAKDKKEVYD-FMEK-------------RLGLKRQTLEARIARIERKVRA
MESDPFQW--RNFDCVAKILHMLRMYLCAR-GQVPGAVNALVQVIPSDRKEDDDEEEDNN
PWKRVKNEPKVDIKNEASTSNPE------------------------------PAMKEHV
PE------PLP-------------------------------------------------
------------------------------------------------------------
--------------
>gi|15230726|ref|NP_189641.1|	   145 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------MENDGASTVCPLDL----GSQMF-LSGDGFEPASVL
FPHAAF--HFPPKDKKEAYD-FMDK-------------RLGLKSLPLEARIARVERKVRA
MESDHFQSNWR----------------KVR-GQDPDYASDLPPCPWSSPSEEDDEEEDSN
HWKRVKNEPEVDDKNEASTSNAD------------------------------PAMK---
------------------------------------------------------------
------------------------------------------------------------
--------------
>gi|22327356|ref|NP_680338.1|	   160 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------MENEGASTVCPLDP----SSLLF-LSGDGFEPAGVF
FPHAAF--YFPPKDKKEAYD-FMDKVVDKHHRMCDERQRLGLKRHTLEAHIARVERK---
----ELRLCRKDPDYAPDVPLRLRSSFGAC-EYSGRDMDFNLRC------------SESM
PDFSRVGITDGDVPNVPGRRPSP------------------------------PRGFFRF
Q---------I-------------------------------------------------
------------------------------------------------------------
--------------
>gi|5732030|gb|AAD48931.1|AF147260_2	   437 residues, 50 /line  contains similarity to Drosophila suppressor of sable protein (GB:M57889) [Arabidopsis thaliana]
-----METEGNVFRCFKT-----RKDTILPAFDRWRPAIRERFL-------------LHA
HHSSRMLTLFPCYLVQAINELNDMIEYYEKLLLDREKEALTWKDKSSSLESDLRSSHDTR
QK--------------PRGST-RQSLLRTHEVQWRVAGSIPELKYKAVANYRDAE-----
-------------------------------LGRSASKARKEVKGRGMELIQGAIVFIQT
KKARTELESDIKEYESNLLLLDQTHEDDFSEEQERNELK---TVLEEKRSRLAALPSSSF
NPQQFKEFFTESPPLSESGLHWA----------E--------------------------
------------------------------------------------------------
----------------IYLVNTFRMENEGASTVCPLDP----GSPLF-LSGEGFEPAGVL
FPHACF--HFPSKDKKEAYD-FMDKVVDKHRRLCDERQRLGLKRQTLEARIARIERKVRA
MESDPYQWEWRNFDYMAKIPHMLRMYLRAR-GQVPGPVNAPVQVILSDSEDGDDEEDDSN
PWKRVKNKPDVDAKNETSTSNSE------------------------------PAMKEPV
PE------PLP-------------------------------------------------
------------------------------------------------------------
--------------
>gi|15235823|ref|NP_192517.1|	   198 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------MANEGVSLICPLDL----GIPLF-LYGDSFDPTSVL
FPHYVF--YFPPKDKKESYD-FADKVIEKHRRACDERQHLGLKRQTLEARIAQMERK---
------------------------MYLGSQ-GRVPDPNRVPVKVIPFDSEEG-DEEEDIN
TWKRVKTNPRWATKPRRPLQNMEIDL-------------YSTETVP--DHSADGMIREEV
PKVPDQRPPLPRGYFRSEIWTPCTLIKDLPERDQ--------------------------
------------------------------------------------------------
--------------
>gi|22327286|ref|NP_680307.1|	   248 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------MENKGASTVCPLDP----GSPLF-------------
FPHAAF--HFPPKDKKEAYD-FIDKAVSRPQKA-NAR---GLHR----------------
-------------SCRKEGSRLCSGCIYAR-DQVLGPVNAPVEVIPSDSEEDDDEDEDSN
PWKRVKN----DKKNEASNSNLEPAMKELGKLDGVSVSANNFDLKWDCDLEGVGMMDEDI
PNVPDRKPSPPRDFFRSQIRAPCALIKELSDRDQEIAMAFIKDLAVQH-------QKRSL
EKKKLQKKINQMLRRVTAISREL--------------HTLNT------------------
-----ILDLASQGV

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.