Fandom

Proteins Wiki

At2g14120.1/MSA

< At2g14120.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|42569021|ref|NP_565363.2|	   780 residues, 50 /line  dynamin-like protein 2b (ADL2b) [Arabidopsis thaliana]
MSVDDL----------------PPSSASA--------------------VTPLGSSVIPI
VNKLQD-IFAQL--G--SQSTIALPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRR
PLRLQLVQTKPSS-----------------------------------------------
--------DGGSDEEWGEFLHHDPVRRIYDFSEIRREIEAETNRVSGENKGVSDIPIGLK
IFSPNVLDISLVDLPGITKVPVGDQPSDIEARIRTMILTYIKEPSCLILAVSPANTDLAN
SDALQIAGNADPDGHRTIGVITKLDIMDRGTDARNHLLGKTIPLRLGYVGVVNRSQEDIL
MNRSIKDALVAEEKFFRSRPVYSGLTDRLGVPQLAKKLNQVLVQHIKALLPSLKSRINNA
LFATAKEYESYGDITE-----SRGGQGALLLSFITKYCEAYSSTLEGKS-KE-MSTSELS
GGARILYIFQSVFVKSLEEVDPCEDLTADDIRTAIQNATGPRSALFVPDVPFEVLVRRQI
SRLLDPSLQCARFIFDELVKISHQCMMK----ELQRFPVLQKRMDEVIGNFLREGLEPSQ
AMIRDLIEMEMDYINTSHPNFIGGTKA--VEQAMQTVKSSRIPHPVARPRD---------
TVEPERTASS-----------GSQIKTRS-------------------------------
-----------FLGRQA-NGIITD-----QAFPTAADAE-----------------RP--
APAGSTSWSGFSSIFRGSD---GQAAAKNN------------------------------
LLNKPFSETTQE-------------------------------VYQN------LSTIYLK
EPPTI-LKSSETHSEQESVEIEITKLLLKSYYDIVRKNVEDLVPKAIMHFLVNYTKRELH
NVFIEKLYRENLIEELLKEPDELAIKRKRTQETLRILQQANRTLDELPLEA-ESVERGYK
IGSEA-KHEELPGTRRSR--------------------------------TETNGNGR--
----------------LH-----------------------M
>gi|108876817|gb|EAT41042.1|	   839 residues, 50 /line  dynamin [Aedes aegypti]
-----------------------------------------------------MDSLIPI
VNKLQD-AFTQM--G--VHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRR
PLILQLINGT--------------------------------------------------
-------------VEYGEFLHQ-KGKKLTNFDEIRQEIEAETDRVTGSNKGISNIPINLR
VYSPHVLNLTLIDLPGLTKVPIGDQPADIENQIKGMIFQFIRKETCLILAVTPANTDLAN
SDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIE
GRKDIHAALSAERKFFLSHPSYRHIADRLGTPYLQKVLNQQLTNHIRDTLPGLRDRLQKQ
LLTLEKDVEQFKHFRP---D-DPSIKTKAMLQMIQQLQSDFERTIEGSGSAL-VNTNELS
GGAKINRIFHERLRFEIVKMSCDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKKQI
SQLKEPILKCIDLTVQELSNVVRIC-TD----KMARYPRLRDETERIITTHIRNCEQRAK
EQLLLMIDYELAYMNTNHEDFIGFANA--QNKTESAAKTGT--RSLGNQ---------VI
RKGHMCIQNLGIMKGGSRP---------------------YWFVLTSESISWFKDEDEKE
KK-----------------------------YMLPLDGL---------------------
-----KLRDIEQGFMSRRH------------------------TFALFNPDGRNVYKD--
YKQLELSC-------ESTDDVD----SWKASF---LRAGVYPE----K----DSSAN-GE
DESNDV-SQTSSLDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNCKDFIN
GELLAHLYATGDQASMMEESQEEAQKREEMLRMYHACKEALRIIGDVSMAT-FSTPVPPP
VKNDWLSSGL-------DNPRLSPPSPGGPRKNVPVQQGSLGSAGAPAGAG--RGPPPAP
TSARPAPAIPNRPGGGGAPPLPQGRP-GGQALPAPLIPSR-R
>gi|66505499|ref|XP_394399.2|	   830 residues, 50 /line  PREDICTED: similar to shibire CG18102-PD, isoform D isoform 1 [Apis mellifera]
---------------------------MA--------------------GNAGMEQLIPI
VNKLQD-AFTQL--G--VHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRR
PLILQLINST--------------------------------------------------
-------------TEYAEFLHC-KGKKFVDFDEVRKEIEAETDRVTGSNKGISNIPINLR
VYSPNVLNLTLIDLPGLTKVPIGDQPADIEAQIKAMIFQFIKRENCLILAVTPANTDLAN
SDALKLAKEVDPQGVRTIGVITKLDLMDDGTDARDILENKLLPLRRGYIGVVNRSQKDIE
GRKDIKNALAAERKFFLSHPSYRHLADRLGTPYLQRVLNQQLTNHIRDTLPALRDRLQKQ
LLTLEKDVEQYKHFRP---D-DPAIKTKAMLQMIQQLQSDFERTIEGSGSAQ-INTMELS
GGAKINRIFHERFPFEIVKMEFDEKELRREIAFAIRNIHGIRVGLFTPDMAFEAIVKKQI
NRLKEPSLKCVDLVVQELSNVVRIC-TD----RMSRYPRLREETERIITTHIRQREQLCK
EQLILLVDCELAYMNTNHEDFIGFANA--QQSSENAVKSGR--HTLGNQ---------VI
RKGYMCIHNLGIMKGGSRD---------------------YWFVLTSESISWYKDEEERE
KK-----------------------------YMLPLDGL---------------------
-----KLRDLEQGFMSRRH------------------------LFALFNPEGRNVYKD--
YKQLELSC-------ETQDDVD----SWKASF---LRAGVYPE----K----STEQANGE
GEG-GS-EAQSSMDPQLERQVETIRNLVDSYMKIVTKTTRDLVPKTIMLLIINNAKDFIN
AELLAHLYASGDQASMMEESPEEAQKREEMLRMYHACKEALRIIGDVSMAT-VSTPVPPP
VKNDWLASGE--------NPRLSPPSPGGPRRGV--------TQPPPLSSS--RAPPPVP
TGGRPAPAIPNRPGPGGPPP-ARATP-G---LPPPLIPS---
>gi|114675369|ref|XP_512382.2|	   826 residues, 50 /line  PREDICTED: dynamin 2 [Pan troglodytes]
----------------------------M--------------------GNRGMEELIPL
VNKLQD-AFSSI--G--QSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRR
PLILQLIFSK--------------------------------------------------
-------------TEHAEFLHC-KSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLR
VYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLAN
SDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIE
GKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPALRSKLQSQ
LLSLEKEVEEYKNFRP---D-DPTRKTKALLQMVQQFGVDFEKRIEGSG-DQ-VDTLELS
GGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQV
VKLKEPCLKCVDLVIQELINTVRQC-TS----KLSSYPRLREETERIVTTYIREREGRTK
DQILLLIDIEQSYINTNHEDFIGFANA--QQRSTQLNKK----RAIPNQGE-----ILVI
RRGWLTINNISLMKGGSKE---------------------YWFVLTAESLSWYKDEEEKE
KK-----------------------------YMLPLDNL---------------------
-----KIRDVEKGFMSNKH------------------------VFAIFNTEQRNVYKD--
LRQIELAC-------DSQEDVD----SWKASF---LRAGVYPE----K----DQAEN---
-EDGAQ-ENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIH
HELLAYLYSSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTST-VSTPVPPP
VDDTWLQSAS----SHSPTPQRRPVSSIHPPGSAPAVRGPT---PGPVRIP--PGIPPGV
LSRRP-PAAPSRP-----------------TIIRPAEPSLLD
>gi|487851|gb|AAA37318.1|	   743 residues, 50 /line  dynamin
----------------------------M--------------------GNRGMEDLIPL
VNRLQD-AFSAI--G--QNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRR
PLVLQLVNST--------------------------------------------------
-------------TEYAEFLHC-KGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLR
VYSPHVLNLTLADLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLAN
SDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDID
GKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQ
LLSIEKEVDEYKNFRP---D-DPARKTKALLQMVQQFAVDFEKRIEGSG-DQ-IDTYELS
GGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQV
QKLKEPSIKCVDMVVSELTSTIRKC-SE----KLQQYRRLREEMERIVTTHIREREGRTK
EQVMLLIDIELAYMNTNHEDFIGFANA--QQRSNQMNKK----KTSGNQDE-----ILVI
RKGWLTINNSGIMKGGSKE---------------------YWFVLTAENLSWYKDDEEKE
KK-----------------------------YMLSVDNL---------------------
-----KLRDVEKGFMSSKH------------------------IFALFNTEQRNVYKD--
NRQLELAC-------ETQEEVD----SWKASF---LRAGVYPE----RVGDKEKASE--T
EENGSD-SFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIF
SELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIG---------------
------------------------------------------------------------
------------------------------------------
>gi|71834414|ref|NP_001025299.1|	   755 residues, 50 /line  hypothetical protein LOC559334 [Danio rerio]
----------------------------M--------------------GNRGMEELIPL
INKLQD-AFSSI--G--QSCNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRR
PLILQLVNNK--------------------------------------------------
-------------AEYAEFLHC-KGRKFVDFDEVRQEIEAETDRITGSNKGISPIPINLR
VYSPNVLNLTLIDLPGMTKVAVGDQPPDIEHQIRDMIMQFITRESCLILAVTPANMDLAN
SDALKVAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDID
GRKDIRAALAAERKFFLSHPSYRHMAERMGTPHLQKALNQQLTNHIRDTLPGLRSKLQSQ
LLSLEKEVEEYKNFRP---D-DPTRKTKALLQMVQQFGVDFEKCIEGSG-DQ-VDTAELS
GGARINRIFHERFPFELVKIVFDEKELRREISHAIKNVHGVRTGLFTPDLAFEAIVKKQI
IKLKEPCLKCIDLVIQELINTFRQC-TN----KLSSYPRLREETERIVTTYVREREGKTK
DQVLLLIDTELSYINTNHEDFIGFANA--QQRNIVNK-K----RAIPNQ---------VI
RKGWLTL-NISIMKGGSKE---------------------YWFVLTAESLSWYKDEEEKE
KK-----------------------------YMLPLDNL---------------------
-----KLRDVEKGFMSTKH------------------------IFAIFNTEQRNVYKD--
LRQIELAC-------DSQEDMD----SWKASF---LRAGVYPE----K----DQVES---
-EEAAP-ADSFSMDPQLERQVETIRNLVDSYIGIVNKTIRDLMPKTIMHLMINSAKDFIH
SELLAYLYSSGDQNSLMEESADQAQRRDEMLRMYHAIKEALSIIGDISTST-ISTPVPPP
VNDSWIPET---------------------------------------------------
-----------------------------------------R
>gi|115111533|gb|ABI84147.1|	   809 residues, 50 /line  dynamin isoform A [Lymnaea stagnalis]
---------------------------MS--------------------GNVGMEHLIPI
VNKLQD-VFASL--G--VPLSLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRR
PLVLQLMYSR--------------------------------------------------
-------------VEYAEFVHC-KGKKFTDFALVRKEIEDETDRVTGSNKGISNIPINLR
VFSPNVLNLTLIDLPGMTKVPVGDQPADIEQQIRGMLMEFITKESCLILAVTPANSDLAN
SDALKIAKEVDPQGLRTIGVITKLDLMDDGTDAREILENKLLPLRRGYIGVVNRSQRDIE
GKKDIRAALAAERKFFLSHQSYRHMADRLGTPHLQKVLNQQLTNHIRDTLPSLRNKLQSQ
MLAMEKEVEEYKNFRP---D-DPARKTKAMMQMISQFSTDFERDIEGFG-TH-VSTEDLS
GGAKINRIFHERFPFELVKMEFDERELRKEIAITIKNIHGIRTGLFTPDMAFESIVKKQI
NRLKEPSLHCVDLVVTELSSVVRKC-TE----KMLRYPRLREETERIVNTRIREQEQVAK
QQILQLIDIQLSYMNTNHEDFIGFANFSAQQKSENT---NK--KELGNQ---------VI
RKGWLSLHNVSFIKGGSKD---------------------FWFILTAESLSWYKDEEEKD
KK-----------------------------YMLPLEGL---------------------
-----KLRDLESGIFSRHP------------------------IFALFNAENRNVYKD--
YKQLELSA-------ESQDEVD----SWKASF---LRAGVYPE----R----STDEG---
-GSQTK-DDYSSMDPQLERQVETIRNLVDSYLKIVNKTQRDLVPKTIMYLIISNIRGFID
GDLLAHIYSTGDQNQMMEESAEEAQRREEILRMYHATKEALQIIGEVSTTT-VSTPTPPP
VKDDWLSAEENMNSSGGPSYNNRPPSPARPRA----------------------------
-----VPPLPNRPMDQPLQP-VRAAP-GVPNRPAP-------
>gi|125846146|ref|XP_686251.2|	   775 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
----------------------------M--------------------GNRGMEELIPL
VNRLQD-AFSAI--G--QNCDLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRR
PLVLQLISSA--------------------------------------------------
-------------SEHAEFLHC-KGKKFTDFDDVRREIEAETDRVTGTNKGISSIPINLR
VFSPNVLNLTLIDLPGITKVPVGDQPADIEYQIRDMIMQFICKENCLILAVTPANMDLAN
SDALKLAKDVDPQGHRTIGVITKLDLVDKGTDVRDVLENRLLPLRRGYIGVVNRSQKDIE
GKKDISAALAAEKRFFKSHPAYRHMADYMGTPYLQRLLNQQLTNHIRDTLPALRSRLQAQ
LLSLDKEAEEYKGLNP---D-DPSRKTKALMQLIQHFGLDFEKRIEGSG-DQ-VDTVQLS
GGAKINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQI
VKLKGPCLKCVDMVIQELINTVQQC-TN----KLESFPKLREETERIVTTHIRERESQTK
DQVLLSLEIQLSYINTNHEDFIGFANA--QQKTSQLSNK----PSAGNQ---------VI
RKGWVIINNISLIKGGSKE---------------------YWFVLTAESLSWFKDDEEKE
KK-----------------------------YMLPLDNL---------------------
-----KVRDIEKSFMSSKH------------------------VFAIFNTEQRNVYKD--
YRHLELAC-------DTQDDVD----SWKASL---LRAGVYPE----K----TTADG---
-DGSSQ-TESFSMDPQLERQVETIRNLVDSYMSIVYKSIRDLMPKTIMHLVINNVEEFIH
SELLAQLYSSGDQYSLMDESPEQALRREEVLRTHAALKEALNIITDISTTT-ISTPLPPP
VDNSWLSSG----SLHRRYLQLSPSSSAGDR-----------------------------
-----------------------------------------S
>gi|26349871|dbj|BAC38575.1|	   819 residues, 50 /line  unnamed protein product [Mus musculus]
----------------------------M--------------------GNREMEELIPL
VNRLQD-AFSAL--G--QSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRR
PLVLQLVTSK--------------------------------------------------
-------------AEYAEFLHC-KGKKFTDFDEVRHEIEAETDRVTGMNKGISSIPINLR
VYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIRDMIMQFITRENCLILAVTPANTDLAN
SDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDID
GKKDIKAAMLAERKFFLSHPAYRHIADRMGIPHLQKVLNQQLTNHIRDTLPNFRNKLQGQ
LLSIEHEVEAFKNFKP---E-DPARKTKALLQMVQQFAVDFEKRIEGSG-DQ-VDTLELS
GGAKINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQI
VKLKGPSLKSVDLVMQELINTVKKC-TK----RLANFPRLCEETERIVANHIREREGKTK
DQVLLLIDIQVSYINTNHEDFIGFANA--QQRSSQVHKK----STIGNQ---------VI
RKGWLTVSNIGIMKGGSKG---------------------YWFVLTAESLSWYKDDEEKE
KK-----------------------------YMLPLDNL---------------------
-----KVRDVEKGFMSSKH------------------------VFALFNTEQRNVYKD--
YRFLELAC-------DSQEDVD----SWKASL---LRAGVYPD----K----SVGSNKTE
NDENGQ-AENFSMDPQLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFIN
SELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALAIIGDINTAT-VSTPAPPP
VDDSWLQHSR---RSP-------PPSPTTQRRLTI------------------SAPLPRP
TSGRG----PGSRYPLSRPPL-RSSPSSIPSWPITSFSQQ-Q
>gi|115441881|ref|NP_001045220.1|	   818 residues, 50 /line  Os01g0920400 [Oryza sativa (japonica cultivar-group)]
---------MEDGIYSSSAPPSTATAAAA--------------------AAAVGSSVIPI
VNKLQD-IFSQL--G--SSSTIDLPQVAVVGSQSSGKSSVLEALVGRDFLPRGSDICTRR
PLVLQLVHQPRRP-----------------------------------------------
--------ADAEADEWGEFLHL-PGRRFYDFREIRREIQAETDREAGGNKGVSDKQIRLK
IYSPNVLNITLVDLPGITKVPVGDQPTDIEARIRTMILSYIKHKTCIILAVSPANADLSN
SDALQIARNADPDGSRTIGVITKLDIMDRGTDARNFLLGNVIPLRLGYVGVVNRSQQDIK
SDLSIKEALAREESFFRNHPAYNGLAQYCGIPQLAKKLNQILVQHIKTVLPGLKSRISSQ
LTTTAKELSFYGDPVE-----SKAGQGAKLLNILAKYCEAFSSMVEGKN-ED-ISTIELC
GGARIHYIFQSIYVKSLEDVDPCEDVTDEDIRMAIQNATGPRSALFVPEVPFEVLVRRQI
SRLLDPSLQCAGFIYDELVKMSHRCLAV----ELQQFPLLRRSMDEVIGRFLRDGLKPAQ
DMIAHIIEMEADYINTSHPNFIGGSKA--VEQAQQQVRSSRLAAVAR--RE---------
GVDADKSQAS-----------DKTQKPRA-------------------------------
-----------LLGRTGVNGVVTD---HLQGLRPAAEAE-----------------RPGS
SGSGSTSFWGSISIFSSTSDDRTHSSAKDN------------------------------
SSNKSYTASTSH-------------------------------LEHS------LSTIQLR
EPPVV-LKPSESQSEQEALEIAITKLLLKSYYNIVRKNVEDFVPKAIMHFLVNHTKRELH
NYLITKLYRDDLFADMLREPDEITIKRRQIRDTLKVLQQAYKTLDEIPLEA-DTVERGYS
LDADATGLPRAHGLSSSFQDGSSPYS----------------TPKQPRSRKSSHSGEQ--
-----LPFNPDASGNG-------------------------F
>gi|140071759|gb|ABO84637.1|	   760 residues, 50 /line  Dynamin central region; Dynamin; Dynamin GTPase effector [Medicago truncatula]
----------------------MAAVSND--------------------GAPLGSTVISL
VNKLQD-IFSRV--G--SQSTIDLPQVAVVGCQSSGKSSVLEALVGRDFLPRGNDICTRR
PLVLQLVHIPP-------------------------------------------------
-----------SKPESAEFLHL-PGRTFHDFSQIRAEIQAETDREAGGNKGVSDKQIRLK
IFSPNVLDITLVDLPGITKVPVGDQPSDIESRIRTMIMSYIKVPTCLILAVTPANSDLAN
SDALQMAGNADPDGHRTIGVITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIL
TNRSIKDALVAEEKFFRSHPIYSGLADSCGVPQLAKKLNKILAQHIKAVLPGLKARISAS
LVNLAKEHASYGEITE---SKACAGQGALILNILSKYSDAFTSIVEGKN-EA-MSTSELS
GGARINYIFQSIFVRSLEEVDPCEDLTDDDIRTAIQNATGPRAALFVPDVPFEVLVRRQI
SRLLDPSLQCARFIYDELMKISHRCMVT----ELQRFPFLRKRMDEVIGNFLREGLEPSE
TMITHIIEMEMDYINTSHPNFIGGSKA--LEAAVQQTKSSTVSKV----KD---------
AVESDKGSAS-----------ERSGKSRS-------------------------------
-----------ILARHA-NGGMAD-----HGVRASSDID-----------------KVLH
SGTTSGSSWGISSIFGGGD---NRVSVKEN------------------------------
TNSKHHNDPVQS-------------------------------VLPS-------STIHLR
EPPTV-LRPSERSSETLAVEIAVTKLLLRSYYEIVRKNVEDLIPKAIMHFLVNNTKRELH
NVFIANLYRDDLFEEMLQEPNEIAVKRKRCRELLRAYQQAFRDLDELPLEA-ETAEWGHS
SPE-TTGLPKIRGLRNFF------------------------------------------
-------------YVF-------------------------Y
>gi|18418260|ref|NP_567931.1|	   808 residues, 50 /line  ADL2 (ARABIDOPSIS DYNAMIN-LIKE 2); GTP binding / GTPase [Arabidopsis thaliana]
MTIEEVSGETPPSTPPSSSTPSPSSSTTN--------------------AAPLGSSVIPI
VNKLQD-IFAQL--G--SQSTIALPQVVVVGSQSSGKSSVLEALVGRDFLPRGNDICTRR
PLVLQLLQTKSRA-----------------------------------------------
--------NGGSDDEWGEFRHL-PETRFYDFSEIRREIEAETNRLVGENKGVADTQIRLK
ISSPNVLNITLVDLPGITKVPVGDQPSDIEARIRTMILSYIKQDTCLILAVTPANTDLAN
SDALQIASIVDPDGHRTIGVITKLDIMDKGTDARKLLLGNVVPLRLGYVGVVNRCQEDIL
LNRTVKEALLAEEKFFRSHPVYHGLADRLGVPQLAKKLNQILVQHIKVLLPDLKSRISNA
LVATAKEHQSYGELTE-----SRAGQGALLLNFLSKYCEAYSSLLEGKS-EE-MSTSELS
GGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPRSALFVPDVPFEVLVRRQI
SRLLDPSLQCARFIFEELIKISHRCMMN----ELQRFPVLRKRMDEVIGDFLREGLEPSE
AMIGDIIDMEMDYINTSHPNFIGGTKA--VEAAMHQVKSSRIPHPVARPKD---------
TVEPDRTSSS-----------TSQVKSRS-------------------------------
-----------FLGRQA-NGIVTD-----QGV-VSADAE-----------------KAQP
AANASDTRWGIPSIFRGGD---TRAVTKDS------------------------------
LLNKPFSEAVED-------------------------------MSHN------LSMIYLK
EPPAV-LRPTETHSEQEAVEIQITKLLLRSYYDIVRKNIEDSVPKAIMHFLVNHTKRELH
NVFIKKLYRENLFEEMLQEPDEIAVKRKRTQETLHVLQQAYRTLDELPLEA-DSVSAGMS
KHQELLTSSK--------YSTSSSYS----------------ASPSTTRRSRRAGDQ---
----------HQNGYG-------------------------F
>gi|38346632|emb|CAE02157.2|	   800 residues, 50 /line  OSJNBa0072D21.2 [Oryza sativa (japonica cultivar-group)]
----------------MAEPAAAAAAAEA--------------------PATVGQAVIPL
VNRLQD-IVARLDGG--GGGGLELPQVAAIGGQSSGKSSVLEALVGRDFLPRGPDICTRR
PLVLQLVRH---------------------------------------------------
----------SAPEEWGEFLHA-PARRFHDFDQIKREIQLETDKEAGGNKGVSEKQIRLK
IFSPNVLDITLVDLPGITRVPVGDQPSDIESRIRSMIMQYIKHPSCIILAVTPANADLAN
SDALQLAKLADPDGSRTIGVITKLDIMDRGTDARNFLLGNVIPLKLGYVGVVNRSQEDIN
FKRSVKDALAFEEKFFSTLPAYHGLTHCCGVPQLAKKLNTILLKHITYMLPGLKSRINSQ
LVAVAKEHAAYGDTAE-----STAGQGVKLLNILRKYCEAFSSMVEGK--NK-VSTDELS
GGARIHYIFQSIFVKSLEEVDPCKSITDEDIRTAIQNSDGPKGPMFLPELPFEILVRRQI
SRLLDPSLQCANFIYDELVKISRGCLTS----ELQKYPILKKRMGEAVSNFLRDGLRPAE
TMITHIIEMEMDYINTSHPNFVGGNKV--VELARQEILPPKAPTSVTIPKD-------GT
AISPEIQLTS-----------DRSQKSRA-------------------------------
-----------IFARDATRGATSD-----QGVQPDADTE-----------------NTGT
SVAGR--------------NQRGHSLVAGS------------------------------
SSSKSV-ARVHS-------------------------------LDNL------ISIIQLR
EPPIT-LKPSENQPAQDATEVAIVKLLIKSYYDIVRKSIEDAVPKAIMHFLVNHTKRELH
NVLIRKLYRENLLDEMLRETDEVIIRRQRIQETLQVLEQAHRTLEEFSLEA-EKVEKGYS
PAEYATGLPKIHGLSNG--DPSIIYA----------------SSPNHNRKKASHEDQHGS
VASYSSTSYPDANGGLLS-----------------------T
>gi|145491851|ref|XP_001431924.1|	   713 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
-----------------------------------------------------MEKLIPF
INDLHDILSQAG--L--S-SELNLPSIVVIGSQSVGKSSLLESIVGREFLPRGKGIVTRR
PIEIQLHQVLD-------------------------------------------------
-----------AELGWFEFMDK-KGEKIFESEDIRKLIESETDKVAGKNKGISPAPIKVK
YFSKDILDLQLIDLPGITKNPVGDQPLDIEQKVLDIVMPFINNQNSLILAVSKASDDLAT
SDGLKLARSVDPNGVRTIGVITQLDLMDEGSDALNDLLNQTYPLQLGYVGVIMRGQKDIQ
KNKTIFEQLKDEKAFFENHKLYKKYSEKMGVNFLVKTLNMNFIQHIKKALPIIRETIISL
VQIKEFDLKQYGDYDN--LE-TKENKNLLVLTLISKFSSSYKDMLEGRC-LD-ITSKELI
GGSRIIYVFNETFRRTIQRMNPFDVLSDDEIRTAIKNANGIRPTLFVPEGAFELLVRQQI
SRLRMPSIECSHIVFEELRRVINQISIP----EIERFDTLANRISEVIENLLNRCLRQTE
EIISSLIDIELGYINTSHPDFVSGMDM--VHKDEQRQQQQMQQQQKEK------------
-----SPLQ--------SENESNRF-----------------------------------
---------------------------------------------FN-----FWPF--K-
NNKQTELYDSKLDNLNKKR---KSNI---------INQKQQKLQQVEE---------SQI
LQQQSVINKIV-------------------------SVNQ---QYFVNDP-----KRQLP
QVPNT-IKITDRPSKREQTEMDMIKDLLVSYFNLVKKNICDSVPKTIITFLVNQSRNFCE
RELIGMLYKQELVDELLQENQFIQKSRAETKQSLISLRTCLNLLNDLDSKF---------
------------------------------------------------------------
------------------------------------------
>gi|145519760|ref|XP_001445741.1|	   709 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
-----------------------------------------------------MEKLIPF
INDLHDILSSAG--L--S-NELNLPSIVVIGSQSVGKSSLLESIVGREFLPRGKGIVTRR
PIEIQLHQVID-------------------------------------------------
-----------AEQSWFEFMDK-RGEKIFESDEIRKLIEQETDKVAGKNKGISPVAIKVK
YFSKDILNLQLIDLPGITKNPVGDQPQDIEQKVLDIVLPFIKNQNSLILAVSKASDDLAT
SDGLKLARSVDPNGLRTIGVITQLDLMDEGSDILNDLLNQTYPLQLGYVGVIMRGQKDIQ
KNKTIQNQLKDEKEFFESHKIYKKYSEKMGIGYLVKTLNMNFIQHIKRALPVIRETIISL
AQMKEYELKQYGDYDN--LE-SKETKNLLVLTLISKFSNSYKDMLEGRC-LD-ITSKELI
GGSRIIYVFNETFRRTIQKMNPFDVLSDDEIRTAIKNANGIRPSLFVPQGAFELLVRQQI
QRLRMPSIECSHIIFEELRRVINQISIP----EIERFDVLSNRIQEVIENLLNKCLIQTD
EIIQNLLEIEIGYINTSHPDFVSGMDL--VNREEQRQQPQQI--IREK------------
-----SPVQ--------SESESGKF-----------------------------------
---------------------------------------------LN-----FWPF--K-
NNKQTELYDSKLDILNNKR---KQNT---------L--KPKKLEQIDE---------SQI
LQQQSVINKIA-------------------------YVNQ---QYYVNDP-----KRQLP
CVPNV-IKLNDRPSKREQTEMDMIKDLIVSYFNLVKKNICDSIPKTIITFLVNQSRNLCE
RELIGVLYKSDSVDELLQENQFIQKSRKETKQTLISLKTCLNLLNELDQKF---------
------------------------------------------------------------
------------------------------------------
>gi|146179027|ref|XP_001020504.2|	   771 residues, 50 /line  Dynamin central region family protein [Tetrahymena thermophila SB210]
-----------------------------------------------------MDKLIPL
INEIHDVLSKSQ--L--S-NQLRLPQIVVIGSQSTGKSSLLESIVGQEILPRGKGIVTRR
PIEIQLKNQQN-------------------------------------------------
-----------AEQDYVEFSER-RGEKITDMDQVRKMIDEDTEKIAGKNKAISNVPLRLK
FYSKNVVDLILVDLPGMTKNPVGDQPQDIEQQILNLIEPYIKNPNSIIMAVSKGSDDLAN
SESLKLSRKIDPQGNRTIGVITQLDLIDEGADVLNDLQNKTYPLKLGYVGVIMRGQKDIK
-IKSIKEQIADEKAYFENHSIYKRVSNKMGIPYLIKLLNLSLMNHIKKTLPNIRENIVQM
LNDRENDLKQYGDYSS--LE-DKKDRGIFVLRLISQFTKSYNSLIQGHY-IQ-TNNDELQ
GGSRIQYIFNNIFRKSITELNPFDILKDEDIRTAIKNADGLRQSLFVAEGAFENLVKQQI
SRLLNPSIQCSHLVYEELRRIINLINVP----EIQRFDNFNNRIFQVMEDVLERSLKPTD
QMIKNLIEVELGYINTNHPDFIGGIEL--VQNQSEQMCKEEEQKRNQQ------------
-----KPQAAQYANKNERGQETDSDA-----------KSVISNKSQAIGG-----IERNQ
KRQQSQNVQATS-------------QSTPT---------DQDSSFWS-----WLPFSSK-
QNKQTELLDSKLKIMNMKK---LAEE---------NQGKDFSDSYSQN---------SPK
GYTRRVYREFMA----------------------PQSYND---DYSINNIN-QGYQGNLP
QVPTN-IRLEDKPSKREMSEAEMIKNLIVSYFNIVKKNINDSVPKTIVSFLVNRSVNIAE
RELVSNLYKEDIFDDLLAENSYIAKQREETKAQMILLRSCLNVLNDLDAKF---------
------------------------------------------------------------
------------------------------------------
>gi|27804351|gb|AAO23012.1|	   768 residues, 50 /line  dynamin [Cyanidioschyzon merolae]
-----------------------------------------------------MERLIPI
VNKLQDLFAETG--L--D-SPIDLPQIMVVGAQSSGKSSVLENVVGESIFPRGTGIVTRR
PIVVQLYCTARERLNQ--SGAPDNM------------FNEDGSYVLSDGAPT--------
-DPRSIPP-GAENQAYAEFLHK-PGVRFYNFDDVRAEIERETDRVTGKNKGISPKAINLR
VYSPHVVNLTVVDLPGLTKVPVGDQPSDIERLIRAMVLSYIERPNAIILAVHPATMDLAT
SDALQIARQADPEGRRTLGVITKLDLMDKGTDAMEMLTGKVIPLKLGYIGVICRGPADLR
AGKSIQQAREDEIRFFRSHPVYRRLLPQLGTNTLARTLSTLLMKHIRDTLPSIRQKMSQQ
LAEWRKELQTLGPA-F---E-GADDLGGALLNVINRYSSEFAKSLEGNS-QQTVNTQELY
GGARINYIFNDIYAKELQSMNAFEGLTREDIRTAIRNATGHRSPLFVPELAFELLVKKQI
THFVPPAYSCVDLVYDELVRLALNCETE----LLQRYENLRSEILACAQNLLRELKQPCL
EMVQNLIAMETSYISVNHKDFIGGNKA--MSQLVRARMEEEERR----------------
TRSAKAANSTDN---AANSAPKESNAN-------------DNRILQPRRR-----NQDEN
AKKNDDARRKDD------------------KSPNKTDASNAEKD---------------A
RSDRNPRGDPTMDNFFNE------------------------------------------
ADEDEEDGNER-RNR---------------------------------------GLHTLP
SVPEH-LKAGEVSSDRDRDDIELIQTLLASYFDVVRVNMMDMVPKAIMSFLVLRARDRMQ
SRLVADLYKPERMSELLNESSDVAERRATAKRMVDLLQRGMAVINEVRDVH-VKEEI---
------------------------------------------------------------
------------------------------------------
>gi|19112806|ref|NP_596014.1|	   781 residues, 50 /line  hypothetical protein SPBC12C2.08 [Schizosaccharomyces pombe 972h-]
-----------------------------------------------------MEQLIPL
VNQLQDLVYNTI--G--S-DFLDLPSIVVVGSQSCGKSSVLENIVGKDFLPRGTGIVTRR
PLILQLINLKRKTKNN--HDEESTS------------DNNSEETSAAG-----ETGS---
--LEGIEEDSDEIEDYAEFLHI-PDTKFTDMNKVRAEIENETLRVAGANKGINKLPINLK
IYSTRVLNLTLIDLPGLTKIPVGDQPTDIEAQTRSLIMEYISRPNSIILAVSPANFDIVN
SEGLKLARSVDPKGKRTIGVLTKLDLMDQGTNAMDILSGRVYPLKLGFVATVNRSQSDIV
SHKSMRDALQSERSFFEHHPAYRTIKDRCGTPYLAKTLSNLLVSHIRERLPDIKARLSTL
ISQTQQQLNNYGDFKL---S-DQSQRGIILLQAMNRFANTFIASIDGNS-SN-IPTKELS
GGARLYSIFNNVFTTALNSIDPLQNLSTVDIRTAILNSTGSRATLFLSEMAFDILVKPQL
NLLAAPCHQCVELVYEELMKICHYSGDS----DISHFPKLQTALVETVSDLLRENLTPTY
SFVESLIAIQSAYINTNHPDFLGVQGA--MAVVLSRKEQNRLMLS-QE-----------N
DEPISSALDTVKPDGI--ELYSSD-------------PDTSVKSITNKATNEITTLKSDD
SAKM-----------------------------------QPLDVLAS-----KRYNNA--
FSTETAERKTFLSYVFGAN---NATRKAMS---------------ID-------KSS---
SYPLNDSLSGG---------------DTNH------KNNHPLK-----MTDL-----SNE
---VE-TMALEDMSEREEVEVDLIKELITSYFNLTRKIIIDQVPKVIMHLLVNASKDAIQ
NRLVSKLYREDFFDTLLIEDENVKSEREKCERLLSVYNQANKIISTVF------------
------------------------------------------------------------
------------------------------------------
>gi|50556172|ref|XP_505494.1|	   769 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
-------------------------------------------------MSASLEDLIPL
VNKLQDLVFNTI--G--S-DTLDLPQVVVVGSQSCGKSSVLENIVGRDFLPRGTGIVTRR
PLVLQLVNLPSEEKDR--PG---------------------------------SSGE---
--VHTRTP-KSNSVEWGEFLHI-PGRQFYDFEEIRKEIENETVRIAGNNKGINRIPINLK
IFSPHVLNLTLVDLPGLTKIPIGDQPTDIERQTRHLICEYIAKPNSIILAVSPANVDIVN
SESLKLARQVDPHGKRTIGILTKLDLMDQGTNAMDILSGRVYPLKLGFIGVINRSQQDIH
ANKPLSDSLEAEREFFQNHPVYRNISHKCGTQFLAKSLNQTLMNHIREKLPDIKAKLNTL
MGQTEQELSSYGVSYL---N-SGESKGTLILQLMTKFASKFVTSIEGTA-A--VSTKELC
GGARIYYIYNDVFGTALSSISPTANLSINDIRTAIRNSTGPRPSLFVPELAFDMLVKPQI
KLLEPPSQRCVELVYEELMKICHNCGSP----ELSRFPKLQAKLIECVSDLLRERLGPTA
SYVESLIAIQRAYINTNHPNFIGAADA--MATVVEEKKQKENASR--------------Q
KDMRRKHMDMLPPNGK--DTPQAIENG----------PDDDSTSSRPGSTEGGKDHQREA
HH--------------------------------------------H-----RTPSTA--
TNASGEPKDTFLNYFFGKD---ADGNPVMPP-----------PGAAG-------VKG---
QFPNGFSSSGG---------------SQKGPH---DKKHISDP-----MDTM-----ASA
FDDMD-LEEGEQLSDREKLETELIRRLIVSYFNIVRESIQDQVPKAVMHLLVNFSKESVQ
NRLVSELYKEALFDALLFEDENLAQEREKCETLLKTYKEASKIIGEVI------------
------------------------------------------------------------
------------------------------------------
>gi|116507844|gb|EAU90739.1|	   830 residues, 50 /line  hypothetical protein CC1G_04008 [Coprinopsis cinerea okayama7#130]
----------------------------------------------------MDQDLITL
VNKLQD-TFANL--G--G-E-LDMPQLVVVGSQSAGKSSVLETIVGKDFLPRGQGIVTRR
PLILQLVHTPIPKEP---------------------------------------------
-----SPN-APPYTEWGQFLHV--DKRFTDFNEIRKEIEQETFRVAGQNKGVSKLPISLR
IFSPNVLDLTLVDLPGLTKIPVGDQPSDIERQIRNLVLDYITKPNSVILAVSAANVDLAN
SEALKLARSVDPQGRRTIGVLTKVDLMDAGTNALDILTGRVYPLKLGFIGVVNRSQQDII
SEKPMSDAIESETEFFRNHPAYRNIAHKNGTKYLAKTLNQVLMNHIREKLPDMKARLNTL
IGQAQQELNSYGDAAI---YGDKNQQGSLILRLMTQFARDFVSSIEGTK-VD-ISTKELS
GGARIYYIFNDVFGQALSSIDATGNLDTQDIRTAIRNSTGPRPSLFVPEMAFDLLVKPQI
KLLEAPSLRA----------------------ELSRFPRLHAQLIETVSDLLRERLGPTS
EYAQSLIEIQAAYINTNHPAFIGGSAA--AAAAPSQPPPRQIPPRPSSAEPPNGFIGGHE
DDEDAASDDISGPNGI--FPPPRDGRSGSVTAALHERSRPSSRTGVSHGHGHGLGAVVKR
SSSKTPLHKDHVVSRDRVSSSTSARGIASS---------SGGGAFGGQRDSRDSGSMST-
SSSPHTARETFLNYFFGQN---GPGPVSGASVDQ---------QRGRGVGGGHYG-GGAG
SQDVGFTPVGR-DVSGAEPALSSGLMAGKRSI---DGNDAAY-----DMKSL----GKHI
EA--VS-ADNGQLSRREEMETNLIRSLITSYFNIVRQSIQDLIPKAIMHFLVNHTSQQVQ
NRLVSALYKPELFAELLNEDEALVAERTRVKALLDAYKDAFKILSEVSLKS-T-------
------------------------------------------------------------
------------------------------------------
>gi|58264714|ref|XP_569513.1|	   832 residues, 50 /line  dynamin protein dnm1 [Cryptococcus neoformans var. neoformans JEC21]
--------------------------------------------------MSMDGDLIAL
VNKLQD-TFNAI--G--G-DAVDLPQIVVVGSQSSGKSSVLETIVGRDFLPRGSGIVTRR
PLILQLIHTPPRSSPRTLENIDDGY-------LPN---LDQT-----PTAGAGVMRP---
--GGRSMG-EGTGAEYAEFLHI--NRRFTDFEEIRKEIEAETFRVAGQNKGVSKLPINLK
IYGPGVLNLTLVDLPGLTKVPVGDQPTDIERQIKNLVLDYISKPNAVILAVSPANVDLAN
SDALKLARSVDPRGLRTLGVLTKLDLMDAGTNALDILTGRTYPLKLGFVGVVNRSQQDIN
ENLPMEDARAKEEEFFRTHPVYRNIAHRCGTKYLAKTLNHVLMNHIREKLPDMKARLNTL
MGQTQQELNAFGDATF---L-GEQHRGSLILKLMTEFSKDFVSSIEGTS-LE-ISTKELS
GGARVYYIFNEVFGHALQGIDPAHNLSLADIRTAIRNSTGPRPSLFVPEVAFDLLVKPQI
KLLEAPSLRCVELVYEELMKICHNCTSP----ELQRFPRLLTQLVEVVSDLLRERLGPTS
DYVSSLISIQAAYINTNHPDFVAGSAA--IARAGAPPTTQISKVQEAT--------SEVD
DEESEAESEASAPNGY--VTHPRSA-----SASVPDIRRPTTALG---------------
--GKETKSRKHIRTASG---SHSGHTSGAR---------QGANALLGA----ASAHNMA-
GTSPHTAKETFLNYFLGGR---NGAGEDAGSVQR---------ALGKSHVMQHHA-QG--
----QYQPQQR-EK-DLLPDLG----GRRGGR---LENSASF-----DMKSL----GKHL
EA--TT-GDEMQLTPREEMETTLIRSLIASYFGITRQTIQDLVPKAIMHLLVNFSRDAIQ
QRLVTQLYKPELFADLLFEDEALVSERTRVKALLDAYKEAFKVLSEVSLKS-T-------
------------------------------------------------------------
------------------------------------------
>gi|71022591|ref|XP_761525.1|	   834 residues, 50 /line  hypothetical protein UM05378.1 [Ustilago maydis 521]
----------------------------------------------------MDVDLIQV
VNKLQE-TFTAI--G--G-DSVDLPQIVVVGSQSAGKSSVLETIVGRDFLPRGSGIVTRR
PLVLQLIHTPSTKEQ--PRQPKQSS-------RPYDLSDGLA-----SDMQRGGSHA---
--SSADTR-SPTYEEYGEFLHL--DKRFTDFNEIRREIENETFRVAGQNKGVSKLPIHLK
IYSPNVLNLTLVDLPGLTKIPVGDQPSDIERQIRNLVTDYVSKPNCIILAVSPANVDLAN
SDSLKLARTVDPQGRRTIGVLTKLDLMDQGTHALDILTGRVYPLKLGFIGVVNRSQQDIN
GNVSMLAARRAEEDFFRSHAAYKNIAHRCGTKYLAKTLNQVLMSHIRDKLPDMKARLNTL
MGQTQQELAAFGDTTF---L-GDQHRGSLVLKLMTQFARDFVASIDGTT-FD-ISTKELC
GGARIYYIFQDVFGHALTSINPTHNLTVQDIRTAIRNSTGPRPSLFVPEAAFELLIKPQI
KLLEPPSLRCVELVYEELMKICHNCTSS----ELQRFPRLHAQLIEVVSELLRERLGPTS
EYVQSLIQIQAAYINTNHPSFVHDSAN--IAREQREAQARKQVALLPASSRR----KSSF
DDPADVSNDFSDDDG-------------DSANSRSLTVNG-----VTSKTGGGR----KE
RAASTNESRPH-------SASAPAHHTIGH---------ASGNA----------FANGS-
SSASGGAKDTFLNYFFGGA---SGLPVGGVGPSA---------GLGGYHAAQPHVHQPR-
-----ISEFSQ-TR-EHKPNA----MSGRTGL---EGNSAAY-----DMKSL----DKHL
EATPIS-SDEYALSDREELETTLIRSLIASYFNIVRLSIQDLVPKAIMHLLVNFSRESVQ
NRLVASLYKENLFEELLYEDEGLTSERKRVKQLLDAYREAFNTLSEVTFKP-SGGST---
------------------------------------------------------------
------------------------------------------
>gi|150856892|gb|EDN32084.1|	   742 residues, 50 /line  hypothetical protein BC1G_02461 [Botryotinia fuckeliana B05.10]
-------------------------------------------------MAA--------
---------------------------LVVGSQSSGKSSVLENIVGRDFLPRGSGIVTRR
PLILQLINVPSEEEDA--------------------------------------PEA---
---HTAAS-VATQPEWAEFHHI-PNRRFTEFQDVKREIENETARIAGNNKGINRSPINLK
IYSPHVLSLTLVDLPGLTKVPIGDQPTDIEKQTRNLISEYIAKPNSIILAVSPANVDIVN
SEALKLARHVDPLGRRTIGVLTKIDLMDHGTNAMDILSGRVYPLKLGFIGVVNRSQQDIQ
GNKTLSEALKSEADFFKHHPAYRNMATRCGTQFLAKSLNTTLMAHIRERLPDIKARLNTL
MGQTQQELASYGDMHF---S-GKEHKGALILQLMTRFASSFIASIDGTS-TE-ISTKELC
GGARIYYIFNSVFGNSLETIDPTTNLSALDIRTAIRNSTGPRPSLFVPELAFDLLVKPQI
KLLEVPSQRCVELVYEELIKICHTCGST----ELTRFPRLQTKLIEVVSDLLRERLGPAS
QYVESLISIQRAYINTNHPNFLGAAAA--MSNVVSNKQEKERRRLIQEEK---------E
RKEHRRRKELEAANGG--ETPEE-EAD----------AVPEKLENLPHRK-----HLQKT
SRSMSPAIRENG-------------TSAMV---------SSMNGL-RG----GSPPKFK-
RQAAGGARDSFLNYFLWQR---RRQEE--RPVQ---------------------------
----------------------------RTPA---QQAREDDY----ELG-R-AQRDYNY
DSPFGN-NAEPALTDREAMETELIRALISSYFNIVRESIADQVPKAVMHLLVNHSKDVVQ
NRLVSELYREDLFGELLYEDDAVKKEREKCEKLLRTYKEAAKIVGEVGI-----------
------------------------------------------------------------
------------------------------------------
>gi|39976917|ref|XP_369846.1|	   802 residues, 50 /line  hypothetical protein MGG_06361 [Magnaporthe grisea 70-15]
-------------------------------------------------MAALGDDLLST
VNKLQDLVFNTI--G--N-DSLDLPQIVVVGSQSAGKSSVLENIVGRDFLPRGSGIVTRR
PLILQLINVPEEDGAA--------------------------------------VDV---
--GYRSPD-AARPGEWAEFHHI-PNRRFTDFGDVKREIENETARIAGTNKGINRQPINLK
VYSPHVLNLTLVDLPGLTKVPIGDQPGDIEKQTRTLISEYIAKPNSIILAVSPANVDIVN
SEALKLARHVDGLGRRTIGVLTKVDLMDHGTNALDILSGRVYPLKLGWVGVVNRSQQDIQ
GNKPMEDALKAESDFFKHHPAYRNISTRCGTYFLAKTLNQTLMSHIRDRLPDIKARLNTL
MGQTQQELASYGDMHF---H-GKEHRGSLILQLMTRFATSFISSIDGTS-TE-ISTKELC
GGARIYYIFNSVFGSSLESIDPTSNLTALDIRTAIRNSTGPRPSLFVPELAFDLLVKPQI
KLLELPSQRCVELVYEELIKICHTCGST----ELSRFPRLQAKLIEVVSDLLRERLGPAS
TYVESLISIQRAYINTNHPNFLGATAA--MSNVVSEKQERERKKIILEER---------E
RREKRRLKELGNGDNA--EDQDDTASV----------AGGDSAGGTALRK-----QVAKA
GRSLSPGLRENG-------------ASGIA---------STLNGMGRS----ASPARFN-
GQGLGNAKDSFLTYFFGKD---GPGGL--PTSQP---------SAPR------HIAQ---
NSHSALAPSSR-RNED---------RMLRSPI---QTYRDTEQ----EMGLE-PGGGDSF
AQPFGH-SGEPALTDREAMETELIRALISSYFNIVRESIADTVPKAIMHLLVNHCKDVVQ
NRLVSELYKEALFEELLYEDDGVVKEREKCEKLLQTYREAAKIISEVV------------
------------------------------------------------------------
------------------------------------------
>gi|82939230|emb|CAI99403.1|	   799 residues, 50 /line  dynamin-related protein 1 [Podospora anserina]
-------------------------------------------------MAALGDDLLAT
VNKLQDLVFNTI--G--N-DSLDLPQIVVVGSQSAGKSSVLENIVGRDFLPRGSGIVTRR
PLILQLINVPSEDEAE------------------------------------DPLAA---
--SYRNPN-QALRNEWAEFHHI-PNRRFTDFGDVKREIENETARVAGSNKGINRQPINLK
IYSPHVLNLTLVDLPGLTKVPIGDQPTDIEKQTRNLISEYIAKPNSIILAVSPANVDIVN
SEALKLARHVDALGRRTIGVLTKVDLMDHGTNALDILSGRVYPLKLGWIGVVNRSQQDIQ
GNKPMEEALKSEMEFFRHHPAYRNIATRCGTQFLAKTLNTTLMAHIRDRLPDIKARLNTL
MGQTQQELASYGDMHF---S-GKEHRGSLILTQMTRFATSFISSIDGTS-TE-ISTKELC
GGARIYYIFNSVFGSSLESIDPTSNLSAHDIRTAIRNSTGPRPSLFVPEMAFDLLVKPQI
KLLESPSQRCVELVYEELIKICHTCGSN----ELSRFPRLQAKLIEVVSDLLRERLGPAS
TYVESLISIQRAYINTNHPNFLGAAAA--MSHVVSNKQERERKRLIQEER---------E
RRERRRLKELG-ANGA--DTPAEEEED----------KGTPEKESIAIRK-----AAAKN
VRSLSPAVRESA-------------SGGLA---------AALNGG-RS----DSPARLN-
GQGLGNAKDSFLNYFFGKD---GAIVPGAPPPHS---------QMGR------HINQ---
MSEPTFSQSMR-RQEE---------KPMRSPM---MPLRSDD-----NLDFT-----SKT
TETADG-SSDPAMTDREAMEAELIRALISSYFNIVRESIADQVPKAIMHLLVNHCKDVVQ
NRLVSELYKESMFEELLYEDDAVKKEREKCEKLLQTYREAAKIIGEVV------------
------------------------------------------------------------
------------------------------------------
>gi|85111713|ref|XP_964068.1|	   801 residues, 50 /line  hypothetical protein [Neurospora crassa OR74A]
-------------------------------------------------MAALGDDLLGV
VNKLQDLVFNTI--G--N-DSLDLPQIVVVGSQSAGKSSVLENIVGRDFLPRGSGIVTRR
PLILQLINVPADDDAE------------------------------------DATHP---
--SYRNPN-AAGRNEWAEFHHI-PNRRFTDFGDVKREIENETARVAGTNKGINRQPINLK
IFSPHVLNLTLVDLPGLTKVPIGDQPTDIEKQTRNLISEYIAKPNSIVLAVSPANVDIVN
SEALKLARHVDPMGRRTIGVLTKVDLMDHGTNALDILSGRVYPLKLGWIGVVNRSQQDIQ
GNKPMEEALKSESEFFRHHPAYRNISTRCGTQFLARTLNTTLMAHIRERLPDIKARLNTL
MGQTQQELASYGDMHF---S-GKEHRGSLILQLMTRFASSFIASIDGTS-TE-ISTKELC
GGARIYYIFNSVFGSSLESIDPTSNLTALDIRTAIRNSTGPRPSLFVPEMAFDLLVKPQI
KLLEPPSQRCVELVYEELIKICHTCGST----ELSRFPRLQAKLIEVVSDLLRERLGPAS
NYVESLISIQRAYINTNHPNFLGAAAA--MSHVVSNKQERERKRLIQEER---------E
RRERRRLKELG-TNAT--ETPIEGEEES---------TTLEKTDNVHVRK-----TAGKG
ARSMSPAVRENG-------------PGSIA---------SALNGA-RS----NSPSRFNG
GQGVGNAKESFLNYFFGKD---GAIVPG-PSNSG---------NIGR------HVNQ---
AMEPTFSQSMR-RPDD---------RQVRAPA---QSMKVDD-----DMDYV----GNAK
GTELSN-DGEPAMTDREAMEAELIRALISSYFNIVRESIADQVPKAIMHLLVNHCKDVVQ
NRLVSELYKETLFEELLYEDDAVKKEREKCEKLLQTYREAAKIIGEVV------------
------------------------------------------------------------
------------------------------------------
>gi|50286467|ref|XP_445662.1|	   776 residues, 50 /line  unnamed protein product [Candida glabrata]
-------------------------------------------------MAS-LEDLIPT
VNKLQDVMYDS---G--I-DTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRR
PLVLQLNNISASSPLI--KENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGAS-S
AIGGSNAT-EIRRDEWGEFLHI-PGRRFYDFSEIRREIESETARIAGKNKGISKIPINLK
IYSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVN
SESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQ
MNKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTL
ISQTEQELSQYGDTGD---I-TKENRAGLVLQLMNKFATAFISSIDGTS-SE-ISTKELS
GGARIYYIYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQI
KLLLEPSQQCVELVYEELVKICHKCGTP----ELSRYPKLKSKLIEVVSDLLRERLFPTR
SYVESLIDIHRAYINTNHPNFLTATDA--MSDIIQSRKRNQENQRAQKML---------E
KEKQNEIQENGTASQN--------------------------------------------
------------------------SKSDIE---------PSIDGT-EL----DSS-----
-KDATKSKDTFLNYFFGKD---KKSQLS-------LSNRDGRFSELN------G------
-YKDDFSSQFQ-QLN------------FNSNL-------------------------NSD
DDAFEN-ANHPKLTEREDLECELIRRLIVSYFDIVREMIEDQIPKAIMCLLVNFCKDSVQ
NRLVTELYRESMFEELLVEDQTLMQDRENALKSLEVYKKASALIGNIL------------
------------------------------------------------------------
------------------------------------------
>gi|119195837|ref|XP_001248522.1|	   791 residues, 50 /line  dynamin-related protein [Coccidioides immitis RS]
-------------------------------------------------MASLGEDLLST
VNKLQDLVFNTI--G--S-DSLDLPQIVVVGSQSSGKSSVLENIVGRDFLPRGSGIVTRR
PLILQLINVPSDRTDV--P-------------------------------EHDEVNV---
--PHTAAS-VAGQGEWAEFHHQ-PGRKYEDFAQVKQEIENETARIAGNNKGINRQPINLK
IFSPHVLNLTLVDLPGLTKVPIGDQPSDIEKQTRNLISEYIAKPNSIILAVSPANVDLVN
SEALKLARHVDPVGKRTIGVLTKLDLMDHGTNAMDILTGRVYPLKLGFIGVVNRSQQDIQ
GGKPLADALKAEAEFFRHHPAYRNMAIRCGTQYLAKTLNTTLMAHIRERLPDIKARLNTL
MGQTQQELASYGNKQF---S-GKEHRGSLILQLMTRFASSFISSIDGTS-SE-ISTKELC
GGARIYYIFNSVFGNSLETIDPTQNLSVLDIRTAIRNSTGPRPSLFVPELAFDLLVKPQI
KLLEIPSQRCVELVYEELIKICHTCGST----ELSRFPRLQAKLIEVVSDLLRERLGPCS
NYVESLISIQRAYINTNHPNFLGAAAA--MSSVIQSKQEQERKAALAEDK---------R
KRERRRLKELGGVNGT--ATPEENEDH----------HEDERHQTLPIRA-------NKV
GRSQSPHIGNLE-------------NSRIS---------SSLNGF-QA----VSQP----
----TGGRDSFLNYFFGKE---GALPAPGPAQ-----------GAAR------HVSH---
STEPSFSQSFR-RSE------------LRSPS---ISHNFPDD-----VTAPSEYG---D
ASLVKD-DTEPALTDREALETELIRRLISSYFNIVRETIADQVPKAIMHLLVNHSKEVVQ
NRLVSELYKEELFPELLYEDDGIKAEREKCEKLLETYKKAAKIVGEVL------------
------------------------------------------------------------
------------------------------------------
>gi|145235845|ref|XP_001390571.1|	   798 residues, 50 /line  hypothetical protein An03g06950 [Aspergillus niger]
-------------------------------------------------MTALSEDLLVT
VNKLQDLVFNTI--G--N-DSLDLPQIVVVGSQSSGKSSVLENIVGRDFLPRGSGIVTRR
PLILQLINIPSERHDK--P-------------------------------ESDEVHI---
--PHTAAS-VAGQYEWAEFHHL-PGRKFDDFALVKQEIEAETARIAGSNKGINRQPINLK
IFSPHVLNLTMVDLPGLTKVPIGDQPSDIEKQTRALILEYIAKPNSIILAVSPANVDLVN
SEALKLARQVDAMGRRTIGVLTKLDLMDHGTNAMDILSGRVYPLKLGFIGVVNRSQQDIQ
SGKSLSDALHAEVDFFRHHPAYRNMANRCGTQFLAKTLNTTLMSHIRDRLPDIKARLNTL
MGQTQQELASYGNKQF---S-GKEHRGSLILQLMTRFASSFISSIDGTS-SE-ISTKELC
GGARIYYIFNSVFGNSLETIDPTHNLTVTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQI
KMLEAPSQRCVELVYEELIKICHTCGSQ----ELLRFPRLQAKLIEVVSDLLRERLGPCS
AYVESLISIQRAYINTNHPNFLGAAAA--MSSVMQNRQEQERRAALADDR---------K
KREKRRLKELGAVNGNPPASPEDEDEQ----------HTDSKTQNIPIRS-----QPTRN
TRSMSPHFGKGQ-------------EGGVT---------ATLNGA-HA----NSHQTA--
FGTTNTTRDSFLNYFFGKD---GAQPASSLPQLS---------SQSR------PYTN---
VNEASISHNTR-RTD------------MRAPI---MSA---DE-----YPPPMEY-----
TGDPKE-DPEAVLSDRELLETELISRLISSYFNIVRETIADQVPKAIMHLLVNHSKDVVQ
NRLVSELYKEDLFAELLYEDDGIKAEREKCERLLDTYKEAAKIVGEVL------------
------------------------------------------------------------
------------------------------------------
>gi|67903774|ref|XP_682143.1|	   794 residues, 50 /line  hypothetical protein AN8874.2 [Aspergillus nidulans FGSC A4]
-------------------------------------------------MAALGENLLVT
VNKLQDLVFNTI--G--N-DSLDLPQIVVVGSQSSGKSSVLENIVGRDFLPRGSGIVTRR
PLILQLINIPSERHDK--P-------------------------------ETDEVHV---
--PHTAAS-VAGQNEWAEFHHQ-PGRKFDDFALVKQEIEAETARIAGNNKGINRQPINLK
IFSPHVLNLTMVDLPGLTKVPIGDQPSDIEKQTRALILEYIAKPNSIILAVSPANVDLVN
SESLKLARQVDPMGRRTIGVLTKLDLMDHGTNAMDILSGRVYPLKLGFIGVVNRSQQDIQ
SGKSLSEALQAELDFFRHHPAYRNMANRCGTQFLAKTLNSTLMSHIRDRLPDIKARLNTL
MGQTQQELASYGNKQF---S-GKEHRGSLILQLMTRFASSFISSIDGTS-SE-ISTKELC
GGARIYYIFNSVFGNSLDTIDPTQNLSISDIRTAIRNSTGPRPSLFVPELAFDLLVKPQI
KLLEPPSQRCVELVYEELIKICHTCGSQ----ELLRFPRLQAKLIEVVSDLLRERLGPCS
SYVESLISIQRAYINTNHPNFLGAAAA--MSSIIQSKQDQERKAALAEER---------R
KREKRRIKELGGPNGNAPT---HPEDE----------EEQPETKNLPIRT-----QSSKG
TRSMSPHIGKIS-------------DTGIT---------ATLNGT-HS----NPP-TA--
FGGANTTRDSFLNYFFGKD---GAQPQLTTSASP---------NQNQ------TRQS---
IHEVNVSSNAR-RTE------------MLSPV---DDY---TT-----VPEYNEA-----
SSVLKD-DSEPAISERELMETELIRRLISSYFTIVRETIADQVPKAIMHLLVNHSKDVVQ
NRLVSELYKEEFFAELLYEDDGIKAEREKCERLLETYKAAAKIVGEVL------------
------------------------------------------------------------
------------------------------------------
>gi|70982791|ref|XP_746923.1|	   800 residues, 50 /line  dynamin-like GTPase Dnm1, putative [Aspergillus fumigatus Af293]
-------------------------------------------------MASLSEDLLIT
VNKLQDLVFNTI--G--N-DSLDLPQIVVVGSQSSGKSSVLENIVGRDFLPRGSGIVTRR
PLILQLINIPSEHNDR--P-------------------------------GDNDVLA---
--PHTAAS-VAGQHEWAEFHHL-PGRKFEDFALVKQEIEAETARIAGNNKGINRQPINLK
IFSPHVLNLTMVDLPGLTKVPIGDQPSDIEKQTRTLILEYIAKPNSIILAVSPANVDLVN
SEALKLARQVDPMGRRTIGVLTKLDLMDHGTNAMDILSGRVYPLKLGFIGVVNRSQQDIQ
SGKSLSEALQAEAEFFRHHPAYRNMANRCGTQFLAKTLNTTLMAHIRDRLPDIKARLNTL
MGQTQQELASYGNKQF---S-GEEHRGSLILQLMTRFASSFISSIDGTS-SE-ISTKELC
GGARIYYIFNSVFGNSLETIDPTHNLTVSDIRTAIRNSTGPRPSLFVPELAFDLLVKPQI
KLLEAPSQRCVELVYEELIKICHTCGSQ----ELLRFPRLQAKLIEVVSDLLRERLGPCS
AYVESLISIQRAYINTNHPNFLGAAAA--MSSVIQNKQDQERKMMLADDR---------K
KRERRRQKEMSSVNGAVPVTPEEEEDH----------SAELRSQNLGNRG-----QTSKN
SRSMSPHVNKGQ-------------DSAIT---------TTLNGV-NT----NPN-TM--
FGATNTTRDSFLNYFFGKD---GMQSSTPLPQPL---------IQQR------QPNH---
LSEPSISQSIR-RQD------------LRSPM---S---LPDD-----YAGSSDYG--GE
ISHHAD-NTEPTLSDRELMETELIRRLISSYFNIVRETIADQVPKAIMHLLVNHSKDVVQ
NRLVSELYKEELFSELLYEDDGIKAEREKCERLLETYKEAARIVGEVL------------
------------------------------------------------------------
------------------------------------------
>gi|111056285|gb|EAT77405.1|	   812 residues, 50 /line  hypothetical protein SNOG_15180 [Phaeosphaeria nodorum SN15]
-------------------------------------------------MASLGEELLNI
VNRLQDLVFNTI--G--N-DSLDLPQIVVVGSQSSGKSSVLENIVGRDFLPRGSGIVTRR
PLILQLINLPSERDDA--D-------------------------------EDDEVHV---
--PHTPAS-VAGQQEWGEFLHI-PGRKFYDFGEVRKEIENETSRIAGNNKGINRQPINLK
IYSPHVLSLTLVDLPGLTKVPIGDQPTDIEKQTRGLITEYIAKPNSVILAVSPANVDLVN
SEALKLARHVDPMGKRTIGVLTKLDLMDHGTNAMDILSGRVYPLKLGFIGIVNRSQHDIQ
TSKSLHDALSDERDFFRHHPAYRNMANKCGTQFLAKSLNQTLMAHIRDRLPDIKARLNTL
MGQTQQELASYGDVAF---T-GKEHRGSLILQLMTRFASSFISSIDGTS-TE-ISTKELC
GGARIYYIFNSVYGNSLEQVDPTMNLSVLDIRTAIRNSTGPRPSLFVPELAFDLLVKPQI
KLLEIPSQRCVELVYEELIKICHTCGST----ELTRYPRLQGKLIEVVSDLLREQLGPCS
TYVASLIDIQRAYINTNHPNFLGAAAA--MSAVINDKEQREKKIAMEAEK---------K
KREKRRLKELNIAEANGGELLENGEEL----------ETPASAKSLPLRK-----HQTQA
SRSMSPAVGRLLN-----------GQGSIS---------GQLNNR-QR------------
-SPPAPQRDSFLNYFFGKD---GATAYANSANTVQ-QPGDNR-PGSR------HVSQ---
NVEPSFAQSIR-TRE------------VRQPTHVLEMLPDEDD---APMSPIRDHGF--E
GGFPSDPESAPALTEREALETELIRRLISSYFNIVRETVADQVPKAIMHLLVNHSKDVVQ
NRLVSSLYKEDLFQELLYEDDTIKAEREKCEKLLKTYKEAAKIVGEVL------------
------------------------------------------------------------
------------------------------------------
>gi|146423668|ref|XP_001487760.1|	   801 residues, 50 /line  hypothetical protein PGUG_01137 [Pichia guilliermondii ATCC 6260]
--------------------------------------------------MS-LQDLIPV
VNKLQDIVTTT---Q--L-ADLDLPILAVVGSQSCGKSSVLENIVGKDFLPRGTGIVTRR
PLVLQLINIKAEDA-----RKVAQY-------SE------------EETEVDLEAHLRKQ
T-SKTKSS-KDQVREWGEFLHI-PKKKFFNFHDIRNEIENETARIAGENKGISRIPINLK
IYSPNVLNLTVVDLPGLTKIPIGDQPTDIERQTRSLILEYIAKPNCIILAVSPANVDLVN
SESLKLARQVDPTGKRTVGILTKLDLMDQGTNALDILKGNVYPLKLGFIGIVNRSQRDIS
ENKLLEDSLFAEQQFFASHPSYKTMSNKCGTRYLAQTLNKILMNHIRDRLPDIKAKLNTL
MGQTEQELAAYGDTPANLND-SKEGRGALVLSLMTKFANSFVNSIEGTSMSE-VSTKELC
GGARIYYIYNEVFGSQLASINPTHNLSIHDIRTAIRNSTGPRPSLFVPELAFDLLVKPQI
KLLEEPSHKCVELVYEELMKIVHNVCSTGIGVELNRYPRLQSKLIEVVSDLLRERLGPTI
KYVELLIEIHTAYINTNHPNFVGAAKA--MSMVVEERQRQMEFNLKDKLK---------L
ASERILNGNRSD-------SPEENSES----------EKD--SDGMDINE-----V--DD
V--IKPVKHK--K-----------TD---SKQNGALRSD----ST-PT------------
-LTGGTPHDSYLNYFFGKD---PITHQQYLQTQAQLNPTPFKFPQQH------ESTL---
KFNSSFVPN---------------------------------ETNGSVSPDMKALSL--S
DLFDSD-ETINELSEREQLECELIRRLIISYFSIVREMIQDQVPKSIMCLLVNYIKQHIQ
NRLVVKLYNDVMFDDLLQEDETIQMEREKCVDLLNTYREASRIISDVV------------
------------------------------------------------------------
------------------------------------------
>gi|45184650|ref|NP_982368.1|	   756 residues, 50 /line  AAL174Cp [Ashbya gossypii ATCC 10895]
-------------------------------------------------MAS-LEDLIPT
VNKLQDVMYDA---G--I-DSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRR
PLVLQLNNIKADSPLI--TAYTA-----------------------EEAEPTLENRLRG-
-------Q-SGARDTWGEFLHL-PGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLK
IYSPHVLNLTLIDLPGITKVPIGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVN
SESLKLARDVDPHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQ
ENKSVEDALAREEEFFSKHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTL
IGQTEQELASYGGSNI---I-SPESRAGLVLQMMNKFATNFVSSIEGTS-SD-ISTKELC
GGARIYYIYNNIFGNSLKSINPTANLSITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQI
KLLLDPSQRCVELVYEELMKICHNCGSP----ALARYPRLQAKLIEVVSDLLRERLGPTR
SYVESLIDIHRAFINTNHPNFLSATEA--MADIAEARRQKQQNAKRSADL---------K
KKRQQELEKAAAVGEPT--NG---------------------------NP-----S--PK
VDSDSTITS------------------------------SDSEGE-DE------------
-RDPKQNKDSFLNYFFGKD---QQRKDG-----DDIAPS---FSDKQ------ERTM---
--DSFFQQEAD-------------------------------------FMAMETLKIQDT
VAAPVE-AEHPELTEREELECELIRRLIISYFGIVREMVEDQIPKAVMCFLVNFCKEEVQ
NRLVSKLYKESLFEELLMEDETLAQDRAKCIKLLEGYKQASVIIGDIL------------
------------------------------------------------------------
------------------------------------------
>gi|50311271|ref|XP_455660.1|	   775 residues, 50 /line  unnamed protein product [Kluyveromyces lactis]
-------------------------------------------------MSS-LEDLIPT
VNKLQDVMYDA---G--I-DSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRR
PLVLQLNNIDPNSPLV--YNYDNSS-------STSLEQVNDEPDARTEKEMTLEDHLRK-
---NSNYK-PEIKNEWGEFLHI-PGRRFYDFSEIRREIENETARIAGKEKGISRIPINLK
IYSPHVLNLTLVDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVN
SESLKLAREIDPHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQ
QNKSVEEALNSEEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTL
IGQTEQELATYGDDKV---I-TKENRAGLVLQLMNKFATKFISSIDGTS-SE-ISTKELC
GGARIYYIYNTLFGKSLNFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQI
RLLLDPSQRCVELVYEELMKICHNCGSP----ELARYPKLQSKLVEVVSELLRERLGPTR
SYVESLIDIHKAYINTNHPNFPSATEA--MAEIVEARKNKKQTERLQKQR---------E
YEKQLLL--------------EQQQAE----------REMKKSDSVDETE----------
--QDLKLDSD--S-----------TAT------------SEHDSE-EE------------
-NDMKQSKDSFLNYFFGKE---QKS------SNTKLSSRI--------------------
----DYNGSDN--------------------------------SYDIENLQIQDFKDKSA
DAHTKS-EAATEFTEREELECELIRRLIVSYFSIVREMIEDQVPKAVMCLLVNYSKESVQ
NRLVTKLYKESLFDELLMEDQTLAQDREKCVNLLETYQKASGIIGDIL------------
------------------------------------------------------------
------------------------------------------
>gi|149245908|ref|XP_001527424.1|	   842 residues, 50 /line  hypothetical protein LELG_02253 [Lodderomyces elongisporus NRRL YB-4239]
--------------------------------------------------MS-LQDLIPV
VNKLQDIVTTT---Q--L-ADIDLPILAVVGSQSCGKSSVLENIVGKDFLPRGTGIVTRR
PLVLQLINIHEDDPIV--SRKVNDS-------ND------------ELEEIDLEDHLRKM
NGGSKNSK-NKKKTEWGEFLHI-PNKRFYNFYEIRREIEKETLRIAGENKGISRLPINLK
IYSPKVLNLTLVDLPGLTKIPIGDQPTDIERQTRNLISEYISKPNCIILAVSPANVDLVN
SESLKLARQVDPTGKRTVGILTKLDLMDQGTNALDILKGNVYPLKLGFIGIVNRSQQDIA
ENKPLEDSLQSEQQFFLNHPAYRSMASKCGTKYLAQTLNKILMNHIRERLPDIKAKLNTL
MGQTEHELASYGDMPN-MGD-SKEARGAMVLTLMTKFANAFMNSIEGTLITE-ISTKELC
GGARIYNIYNEVFGSSLAAINPTHNLSIHDIRTAIRNSAGPRPSLFVPELAFDLLVKPQI
GLLEEPSQRCVEMVYEELMKIVHSVCSSDIGPELSRYPRLQAKLIEVVSDLLRERLGPTI
KYVQSLIEIHRAYINTNHPSFVGAAKA--MSIVVAERQKQKEMELNSKLK---------L
ATQRILGRKLKEAETIE--AIEEGEER----------ADGDEGEGADDEE-----A--ED
TDEGVAKMKE--D-----------IVSVDDDFPKRKRS-SHKKHQ-HH------------
-ESQQPLNESYLNYFLGKD---PIVHQQQMQAQAQLHPTPFKFPHPL------ETTL---
QFNTQFVNNGVINPN------------NSTPSPLIGHKRSESQLSHHDFKNLTINEGYNE
SSFESD-ETINELTEREQMECELIRRLIISYFSIIREMVQDQVPKSIMCLLVNHVKQHIQ
NRLVVKLYSDDMFDELLREDEGIQAEREKCIELLKTYREAARIISDVV------------
------------------------------------------------------------
------------------------------------------
>gi|150863823|ref|XP_001382428.2|	   822 residues, 50 /line  predicted protein [Pichia stipitis CBS 6054]
--------------------------------------------------MS-LQDLIPV
VNKLQDIVTTT---Q--L-AELDLPILAVVGSQSCGKSSVLENIVGRDFLPRGTGIVTRR
PLVLQLMNISENDPVI--NSDTGFR-------SS---SSSFSNGEASDEAVNLEDHLRR-
--HAANGS-YQPPNEWGEFLHI-PHKRFYNFSDIRREIENETHRIAGQNKGISRLPINLK
IYSPRVLNLTLVDLPGLTKIPIGDQPTDIEKQTRNLILEYVSKPNCIILAVSPANVDLVN
SESLKLARQVDPTGKRTVGVLTKLDLMDQGTNALDILKGNVYPLKLGFIGIVNRSQQDIS
DNKSLDDSLFSEQQFFQNHTAYRSMSSKCGTKYLALTLNKILMTHIRDRLPDIKAKLNTL
MGQTEQELASYGEIPSHLKD-SKESRGAMVLSLMTKFATTFMNSIEGTSVNE-LSTKELC
GGARIYYIYNEVFGSQLAAINPTQNLTIHDIRIAIRNSTGPRPSLFVPELAFDLLVKPQI
KLLEDPSRRCVEMVYEELMKIVHNVCSSNIGLELNRYPRLQSKLIEVVSDLLRERLGPTI
KYVESLIDIHKAYINTNHPNFVGAARA--MSIVVEERQKQKEFEQKSKMR---------L
ASERILNKKYSD-------SIEEEEGD----------DEKNP-----DED-----I--NS
VDDVIPVKHK--R-----------SES---GKTYSVKAESTPNLA-GS------------
-QHNHYQQESYLNYFFGKD---PVIHQQHMQTQAQLNPTPFKFPH-H------QESL---
QFNSNFVNGMAN---------------NSQPN-----------LDHFKSMSLTDSIQDDS
TSFESD-ETLNDLTEREQLECELIRRLIISYFCIVREMIQDQVPKSIMCLLVNYIKQHIQ
NRLVVKLYSEDLFNELLQEDEGIQAEREKCMSLLKTYREASRIISDVV------------
------------------------------------------------------------
------------------------------------------
>gi|6323028|ref|NP_013100.1|	   757 residues, 50 /line  Dnm1p [Saccharomyces cerevisiae]
-------------------------------------------------MAS-LEDLIPT
VNKLQDVMYDS---G--I-DTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRR
PLVLQLNNISPNSPLI--EEDDNSV-------NPHDEVTKISGFEAGT-----------K
PLEYRGKE-RNHADEWGEFLHI-PGKRFYDFDDIKREIENETARIAGKDKGISKIPINLK
VFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVN
SESLKLAREVDPQGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQ
LNKTVEESLDKEEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTL
ISQTEQELARYGGVGA---T-TNESRASLVLQLMNKFSTNFISSIDGTS-SD-INTKELC
GGARIYYIYNNVFGNSLKSIDPTSNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQI
KLLLEPSQRCVELVYEELMKICHKCGSA----ELARYPKLKSMLIEVISELLRERLQPTR
SYVESLIDIHRAYINTNHPNFLSATEA--MDDIMKTRRKRNQELLKSKLS---------Q
QENGQTNG-----------------------------------------------I--NG
TSSISSNIDQ--D-----------SAKNS----------DYDDDG-ID------------
-AESKQTKDKFLNYFFGKD---KKG-----------QPVF--------------DAS---
DKKRSIAGDGN--------------------------------IEDFRNLQISDFSLGDI
D--DLE-NAEPPLTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCKDSVQ
NRLVTKLYKETLFEELLVEDQTLAQDRELCVKSLGVYKKAATLISNIL------------
------------------------------------------------------------
------------------------------------------
>gi|108874878|gb|EAT39103.1|	   725 residues, 50 /line  dynamin [Aedes aegypti]
-----------------------------------------------------MEALIPV
VNKLQD-VFNTV--G--S-DAIQLPQIVVLGSQSSGKSSVIESLVGRTFLPRGTGIVTRR
PLVLQLVYTPLDDREH--R-------------------------------SSD-------
------LG-TVNVEEWGRFLHI-KNKIFSDFEDIRREIENETDRMAGSNKGICPEPINLK
IYSTKVVNLTLVDLPGITKVPVGDQPEDIEAQIKDLLVKYIENPNSIILAVTAANTDMAT
SESLKMAKDVDPDGRRTLAVLTKLDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIN
DRKIIEEQLRDEAAYLQRK--YPTLATRNGTPYLAKTLNRLLMHHIRDCLPDLKTRVNVM
ASQFQSLLNSYGD--------DVTDKSQCLLQIITKFASAYCSTIEGTS-RN-IETTELC
GGARICYIFHETFGKTLDSIHPLTGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQI
RRLEEPSLRCVELIHEEMQRIIQHCGT-EVQQEMLRFPKLHEKIVDVVTQLLRRRLPTTN
CMVENLVQIELAYINTKHPDFHKDAAL--VPSLLKTDTQDQWSHLHQPGNP---------
P---SRRALARPNPQQAP-------------------PVPAPQNEPAEMNHVNDQTSNWL
SNILPPA--VGQ------------------------------------------------
---FAAGAAS------------SIQSESVES-----------------------------
SATN-T-PT----------------HGVLSPSKPVNLLP---------------------
-DVPIN-HSSRKLTDKEQKDCDVIERLIKSYFYIVRKSIQDSVPKAIMHFLVNFVKDNLQ
SELVTHLYKSDSANELLNESDHISIRRKEASDMLKALTRANHIISEIRETHMW-------
------------------------------------------------------------
------------------------------------------
>gi|110749491|ref|XP_394947.2|	   721 residues, 50 /line  PREDICTED: similar to Dynamin related protein 1 CG3210-PA isoform 1 [Apis mellifera]
-----------------------------------------------------MEALIPV
INKLQD-VFNTV--G--A-DAIQLPQIVVLGTQSSGKSSVIESLVGRSFLPRGTGIVTRR
PLILQLVYTPKDDREH--R-------------------------------SAE-------
------NG-TLDLDEWGTFLHT-KNKIYIDFSEIRKEIESETERMAGSNKGICPEPINLK
IYSTSVVNLTLIDLPGITKVPVGDQPEDIESQIRQLVLKYICNPNSIILAVVTANTDMAT
SESLKLSKDVDPDGRRTLAVVTKLDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIM
NNKSIQDALKDEAAFLQRK--YPTLANRNGTPYLAKTLNRLLMHHIRDCLPELKTRVNVM
VSQFQTLLNSYGE--------DVSDKSQTLLQIITKFASSYCSTIEGTA-RN-IETTELC
GGARICYIFHETFGKTLDSIHPLAGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQI
RRLEEPSLRCVELVHEEMQRIIQHCGT-EVQQEMLRFPKLHERIVDVVTQLLRRRLPPTN
QMVENLVAIELAYINTKHPDFHKDAAL--VSSLLKNSNVDHIKH----------------
----NRKVPSTTNTTSMT-------------------SLPEQNKDQGHQMVL----SNWL
LNNLIPQGRTDS------------------------------------------------
---TSSIDNSPVRN------RESSTSPHPNP-----------------------------
SSNP-IIEV----------------QKASSQQKPVNLLP---------------------
-EVP-V-QTSRKLSEREQRDCDVIERLIKSYFYIVRKSIQDSVPKAVMHFLVNYVKDNLQ
SELVTHLYKSHHAEVLLNESEHVAVRRKEAADMLKALTQAGHIISEIRETHMW-------
------------------------------------------------------------
------------------------------------------
>gi|24581168|ref|NP_608694.2|	   735 residues, 50 /line  Dynamin related protein 1 CG3210-PA [Drosophila melanogaster]
-----------------------------------------------------MEALIPV
INKLQD-VFNTV--G--S-DSIQLPQIVVLGSQSSGKSSVIESVVGRSFLPRGTGIVTRR
PLVLQLIYSPLDDREN--R-------------------------------SAE-------
------NG-TSNAEEWGRFLHT-K-KCFTDFDEIRKEIENETERAAGSNKGICPEPINLK
IFSTHVVNLTLVDLPGITKVPVGDQPEDIEAQIKELVLKYIENPNSIILAVTAANTDMAT
SEALKLAKDVDPDGRRTLAVVTKLDLMDAGTDAIDILCGRVIPVKLGIIGVMNRSQKDIM
DQKHIDDQMKDEAAFLQRK--YPTLATRNGTPYLAKTLNRLLMHHIRDCLPDLKTRVNIM
ATQFQSLLNSYGE--------DVSDKSQTLLQIITKFSSAYCCTIEGTA-RN-IETTELC
GGARMGYIFHETFGRTLDSIHPLAGLSKMDILTAIRNATGPRPALFVPEVSFELLVKRQI
RRLEEPSLRCVELIHEEMQRIVQHCGN-EVQQEMLRFPKLHEKIVDVVTQLLRRRLPHTN
VMVENIVAIELAYINTKHPDFHKDAAL--VPSLLKTDSDPYSQINLGQRRA---------
NTPRNHMSPQISSHSAGSQQPQQQQP-----------PQPNSSQQQY--SQVHEQN----
------HVAENS------------------------------------------------
---TPSMASTWLSNILP--PAPTRPDSIENS-----------------------------
TNNT-P-VH----------------NNIVSPVKPVNLLP---------------------
-DVPAN-HNPRRLTDKEQKDCDVIEHLIKSYFYIVRKSIQDSVPKAIMHFLVNYVKDNLQ
SELVTHLYKSDKAETLLNESDHIAVRRKEAADMLKALTRANHIISEIRETHMW-------
------------------------------------------------------------
------------------------------------------
>gi|119608928|gb|EAW88522.1|	   778 residues, 50 /line  dynamin 1-like, isoform CRA_d [Homo sapiens]
MACREGAGSRRARSNGCRLPRRGRRRGGRRRTVGPGPIHCRGRRALGPRVFRVMEALIPV
INKLQD-VFNTV--G--A-DIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRR
PLILQLVHVSQEDKRK--T-------------------------------TGE-------
------EN-GVEAEEWGKFLHT-KNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLK
IFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMAT
SEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDIN
NKKSVTDSIRDEYAFLQKK--YPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVL
AAQYQSLLNSYGE--------PVDDKSATLLQLITKFATEYCNTIEGTA-KY-IETSELC
GGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQI
KRLEEPSLRCVELVHEEMQRIIQHCSN-YSTQELLRFPKLHDAIVEVVTCLLRKRLPVTN
EMVHNLVAIELAYINTKHPDFADACGL--MNNNIEEQRRNRLAREL-PSAV---------
--SRDKSSKVPSALAPASQEPSPAAS-----------AE--------ADGKVASGGGGVG
DGVQEP------------------------------------------------------
-------TTGNWRGMLK--TSKAEELLAEEK-----------------------------
SKPI-PIMP----------------A-SPQKGHAVNLL----------------------
-DVP-V-PVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQ
SELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW-------
------------------------------------------------------------
------------------------------------------
>gi|126338701|ref|XP_001363563.1|	   727 residues, 50 /line  PREDICTED: similar to dynamin 1-like, isoform 4 [Monodelphis domestica]
-----------------------------------------------------MEALIPV
INKLQD-VFNTV--G--A-DIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRR
PLILQLVHVSQEDRGK--A-------------------------------SGD-------
------DN-GVQAEEWGKFLHT-KNKLYTDFDEIRQEIENETERISGSNKGVSPEPIHLK
IFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMAT
SEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDIN
NKKSVSDSIRDEYAFLQKK--YPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVL
AAQYQSLLNSYGE--------PVDDKSATLLQLITKFATEYCNTIEGTA-KY-IETSELC
GGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQI
KRLEEPSLRCVELVHEEMQRIIQHCSN-YSTQELLRFPKLHDAIVEVVTCLLRKRLPVTN
EMVHNLVAIELAYINTKHPDFADACGL--MNNNIETEEQPRNRPPRGPARA---------
--PLTLLSPVAVPFLRGRQKVGSEQR-----------ARPP------AFSRGELEEKQYF
QVLRRP------------------------------------------------------
-------FPSVLESVLR--KKEGRPSVGLNS-----------------------------
RQKN-SVHR----------------KWVFLTLKGIKLL----------------------
---P-V-PVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQ
SELVGQLYKSLLLDDLLTESEDMAQRRKEAADMLKALQRASQIIAEIRETHLW-------
------------------------------------------------------------
------------------------------------------
>gi|71993833|ref|NP_741403.2|	   712 residues, 50 /line  Dynamin Related Protein family member (drp-1) [Caenorhabditis elegans]
-----------------------------------------------------MENLIPV
VNKLQD-VFATL--GRKE-DQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRR
PLILQLNHVALDDESK--R-------------------------------RRS-------
------NG-TLLTDDWAMFEHT-GSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLK
IYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFAT
SEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNIL
DNKLIVDAVKDEQSFMQKK--YPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIM
NAQCQSDLVAFGE--------PVEDKNRTLLQIITRFATAYTSTIEGTA-RN-IETTELC
GGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQI
QRLEEPSLRCVELVHEEMQRMVQHCGF-TTQQEMIRFPRLYDKINEVVSGVLKERLKPTN
ELVENLVAIELAYINTKHPEFTEAN----LVTLLKEELLLDDRHGRSRNRH---------
ASTG---------ERAVSAHGEQQLQ-----------PVPGVNGVDLNAVLQ--------
------QQQQQS------------------------------------------------
---QNQRASNGFLGLFG--NAAA-------------------------------------
-------SS----------------KTSPQEKQSANFLP---------------------
-EVPET-QLGRKLTSREQRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQ
SELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQQASVIISEVRETQVW-------
------------------------------------------------------------
------------------------------------------
>gi|72006449|ref|XP_802001.1|	   738 residues, 50 /line  PREDICTED: similar to dynamin-like protein 1 isoform 6 [Strongylocentrotus purpuratus]
-----------------------------------------------------MEALIPV
INRLQD-VFNTV--G--T-DVIQLPQIVVVGNQSSGKSSVLEGLVGKDFLPRGNGIVTRR
PLVLQMVHVDPEDKRG--A-------------------------------SGE-------
------GE-EITADEWGKFLHT-KNKVYTDFEEIREEIQNETDRMAGTNKGIVHDAIHLR
IYSPKVLNLTLVDLPGLTKVPVGDQPEDIESQIREMLVKYIGNPNSIILAVTSANTDMAT
SESLKLAKEIDPDGRRTLAVITKLDLMDAGTDAVDVLCGRVIPVKLGIIGVVNRSQMDIN
NKKVIDDAVKDESAFLQRK--YPALASRNGTAYLARTLNRLLMHHIRDCLPELKTRVNVM
TSQFQQLMASFGE--------PVEDKSQTLLQIITKFASEYCATIEGTS-RN-IETSELC
GGARICYIFHETFGRTLDSIDPLGGLRTIDILTAIRNATGPRPALFVPEVSFELLSKRQI
RRLEEPSMRCIELVHEEMQRIIAHCG----TQDLLRFPRLHDRIVEVVTTLLRKRLPATN
AMVENIVGIELAYINTKHPDFADASLV--NVLVEQNDRENSRKSTRLAESV-------PE
NREKNDKQPKVILSRYLS-LLCYSLP-----------HFPYSNRLKSPFCNLKYKNKYAL
SN------SSSW------------------------------------------------
---VPSW----VRGSAP--NLKSASSDNLSA-----------------------------
TSTPPQMSS----------------PKVERKRPGINLLP---------------------
-DVPDV-PVSRKLSSREQRDVDVIKRLIQSYFLIVRKNIQDSVPKSIMHFLVNHVQDNLQ
SELVGQLYRQKEIDTLLNESEHMAQRRKDAQEMLQALQKAGQIISEIRETHLW-------
------------------------------------------------------------
------------------------------------------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.