FANDOM


>gi|145328280|ref|NP_001077886.1|	   115 residues, 50 /line  myb family transcription factor [Arabidopsis thaliana]
-----------------------------------------MKLIDW----------KDC
ALMTY--TELI-------LG-------------------FCN------------------
---------------------------------VLMLICRRTSGPMRRAKG---------
-GWT------------PEEDETLRRAV--EKYK---------------------------
----------------------------------------------------G-KRWKKI
AEFFPER-TQVQCL----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------HRWQKVLNPE-LVKGPWTQEVLLSFSCSETFF---G----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------FHF----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------T
>gi|110931664|gb|ABH02831.1|	   259 residues, 50 /line  MYB transcription factor MYB68 [Glycine max]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------MD-RIKGPWSPEEDEALRRLVQTY---GP-R---NWSVISKS--
-----IP-GRSGKSCRLRWCNQLSPEVERRPFTAEEDEAILKAHARFGNK-WATIA-R-F
LNG-RTDNAIKNHWNSTLKRKCSEPLS--E------------------------------
------------------------------------------------------PRPLKR
----------SATVSGSQSGSDLSDS----------------------------------
------------------------------------------------------------
-------------------------------------GLP---------IIL-------A
RSVSVTVAPSNHLAETASSSVTDPAT---LLSLSLPGFDSCDG---------A-------
---NNGPGPNQGPSC-----------------------------GPF---Q--------E
--------------------------IPMLGSQKQ-------------------------
-----------LFS-QEFMKVMQ----------------EMIRVEVRNYMSVLERN----
-GVC------------MQTDAIRNSVLERMGIGRV----------------------E
>gi|115477934|ref|NP_001062562.1|	   319 residues, 50 /line  Os09g0106700 [Oryza sativa (japonica cultivar-group)]
-----------M----------------------------MASCR---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------RGGGGDVD-RIKGPWSPEEDEALQRLVGRH---GA-R---NWSLISKS--
-----IP-GRSGKSCRLRWCNQLSPQVEHRPFTPEEDDTILRAHARFGNK-WATIA-R-L
LAG-RTDNAIKNHWNSTLKRKHHSSLLADD------------------------------
------------------------------------------------------LRPLKR
TTSDGHPTLSSAAAPGSPSGSDLSDS----------------------------------
------------------------------------------------------------
----------------------------------SHHSLPSQMPSSPPHLLL-------P
QHVYRPVARAGGVVVPPPPPPPPPATSL-SLSLSLPGLDHPHP---------DPSTPSEP
AVQLQPPPPSQMPPP-----------------------------TPSCVRQ--------E
--------------------------PPQMPFQLQP--PPPPRP----------------
--------SA-PFS-AEFLAMMQ----------------EMIRIEVRNYMSGSAAV----
-DPR------------SSPDNGVRAASRIMGMAKI----------------------E
>gi|125581090|gb|EAZ22021.1|	   301 residues, 50 /line  hypothetical protein OsJ_005504 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------MGMEAECD-RIKGPWSPEEDEALRRLVERH---GA-R---NWTAIGRG--
-----IP-GRSGKSCRLRWCNQLSPQVERRPFTAEEDAAILRAHARLGNR-WAAIA-R-L
LPG-RTDNAVKNHWNSSLKRKLATATDGGEI-----------------------------
------------------------------------------------------DRPCKR
----------VSPGPGSPTGSERSEL----------------------------------
------------------------------------------------------------
----------------------------------SHGGCGSGSGGGQVFRPVPRPGGFDA
ISAADVVRPPRRRDDNDDDGDDDPLTSL-SLSLSLPGFHHDSA---------RSQ-----
--FQELPSPSRSPSP-----------------------------PPS-------------
--------------------------------------PPAASP----------------
--------SAYPFN-ADLVSAMQ----------------EMIRTEVRNYMAGVGLR----
-AGCGPGA-VAESFMPQLVDGVMGAAAERVGVVTR----------------------Q
>gi|32394464|gb|AAM93930.1|	   193 residues, 50 /line  transforming protein myb [Griffithsia japonica]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------LGMVVR-KVKGPWRPEEDAILTQLVAKL---GP-R---RWTVIASH--
-----IP-GRTGKQARERWLNQLSPDLAKRPWTPEEDRVVMQAHARLGNR-WSEIA-K-L
LKG-RTDNATKNRFNTTIRRQISELAAGNARAD-----------------------S---
------------------------------------------------------VGGASS
VVDSGAPTEMGVASAGEGGGGLVEAS----------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------VMGLSCDGDDR--------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------RNAKRKRDGSHSSH----
-EPM------------SQRTKTLTAS-------------------------------T
>gi|123480766|ref|XP_001323405.1|	   306 residues, 50 /line  Myb-like DNA-binding domain containing protein [Trichomonas vaginalis G3]
-----MSS--TS----------------------------YAPTRAR----------QKV
NKYSKN------------------------------------------------------
--------------------------------------------------T---------
-KWS------------KEEDELFQKLM--KSVP---------------------------
----------------------------------------------------R-PEWGEL
VPFFPGK-SAVQIE----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------ERWEKVINPD-LIKGSWTPEEDETIIKFVNQY---GV-K---NWTKLAEL--
-----LP-GRIGKQCRERWRNHLNPEVNTSPFTPEEDELLIELHAKMGNQ-WVKIS-E-I
MKG-RSDNAVKNRWNSTLKKRLEYDKTGA-------------------------------
------------------------------------------------------TRPRRG
RPSSSA-PKSADDVPKPPKFEEIV------------------------------------
------------------------------------------------------------
----------------------------------------------------KETIKA--
-----------ASPTLPTPMMTPSITDI-PFSLKSPF---SSL---------KSPSILRS
PFTLMSPSISQ------------------------------------------------W
--------------------------SPGDLGTGILFSPKLASP----------------
--------S-RGFN-ADS------------------------------------------
------------IMEPSEVNL--------LTPMFE----------------------K
>gi|125554194|gb|EAY99799.1|	   443 residues, 50 /line  hypothetical protein OsI_021032 [Oryza sativa (indica cultivar-group)]
-----MDF--SCFQPHSGG-------------CDDMPFDSYVQQNGH----------QEL
HLVDHPFNNVT-------DG-------------------HEYYSPSAGGS----------
-----------FL--------------------PFATYY-----DLGHEYY---------
-PQG------------GEKDAVVVDRA--SPTI---------------------------
------------------------RKAS------PHLPLFTPKSEVSHLIGGG-VVGSYK
AFEMNSR-LIRRKR----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------ASGKSLKKAN-VVKGQWTLEEDRKLVKLVEQF---GL-R---KWSHIAQI--
-----LP-GRVGKQCRERWHNHLRPNIKKDTWSEEEDIVLIQTHKEVGNK-WAEIA-K-H
LPG-RTENSIKNHWNATKRRQFARRRSRASSKN---PKSGTLLQNYIKS------LG---
------------------------------------------------------IGPIKS
SVRQAPPESTAVSSSSPASTQKLAEV----------------------------------
------------------------------------------------------------
----------------------------------NGKIRPDSNPSN----------QMVT
QGILTMD-------------ENSYIQTN-SCEELLVSTYDDLC---------LDM-----
-CDHLFETKDETPYQ-----------------------------VYNIDD----------
-----------------------------------------DVD----------------
--------MNYIFNHIDYANKIG----------------HEIDMEMAWDDDVLQDD----
ESAGSSPL-ETPAGLAQINTVHVKEEMDLIEMVTRTQSC------------------G
>gi|125557825|gb|EAZ03361.1|	   329 residues, 50 /line  hypothetical protein OsI_024593 [Oryza sativa (indica cultivar-group)]
-----------------MA-------------TDRMPDSHFMASSNG----------GAC
YQNTHG-------------------------------------------T----------
-----------PI--------------------TMGVPN-----LGCLVAS---------
-IGI------------APSSS---------------------------------------
---------------------------------------LMPERGLATANYNLVANFPED
AAVVP----QQQQL----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------QAASSNSNSG-LIKGGWTREEDEVLRQMVQHH---GD-R---KWAEIAKS--
-----LP-GRIGKQCRERWTNHLHPDIKKGIWTEEEDRKLIRAHQTYGNR-WSAIA-R-S
LPG-RSENTVKNRWNATKRSLNSKRRLRKKNSEQAVPRQPSLLEEYIRS------CQ---
-----------------------------------------------------------H
PLPNETAPPASFDIGGYGTGGTI-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------GASPTPPTVHALGGSTPL-GLVMFLDLLNQATP---------HPPQPDLN
LLNITPVVP---------------------------------------------------
------------------------------------------------------------
-----------------HLNTSG----------------YCLQLDARG------------
NCSMASCR-CNPTGSAP----------------------------------------R
>gi|125594505|gb|EAZ34564.1|	   593 residues, 50 /line  hypothetical protein OsJ_018047 [Oryza sativa (japonica cultivar-group)]
-----------------------------------MPAVK-VEEEEE----------ERN
PVASS--PSVS-------EG-------------------SAHAAALASPT----------
-----------AA--------------------DSIFGRRRKSGPVRRAKG---------
-GWT------------PEEDEKLRKAV--DIYN---------------------------
----------------------------------------------------G-KNWKKI
AESFSDR-TEVQCL----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------HRWQKVLDPE-LIKGPWTQEEDDVIINMVKKH---GP-K---KWSVIARS--
-----LN-GRIGKQCRERWHNHLDPQIRKEAWTVEEERVLARAHCMYGNK-WAEIA-K-L
LPG-RTDNSIKNHWNSSLRKKIDDYNTRD-----ILPVHPPVVGDGLKQ------LPKRP
PADNH--F--------------DLNKEPIICSRDRLGVVHSDPTSHQRASNLKDFKGCAD
YLSLGQPVTSCEASAADDSAFDLATQGMRMDSVHDKGTGNNFVCGKVQGINFLG------
--D-----------------------KGLKINQISDKMGCSRQAKREGEAAINGGGS--S
LQSEAHSVGSLCYQIPK-----------------MEDIAPAQSPVFTANY--------VP
EHSRNVMHSPNGYTTPPTHGKGSDQLSVESILRSAAEKFHGTPSILRRRKRDKPTPAEDN
DLKIGRLSSDDFHTP-----------------------------IGKCTTD--------S
PQSFKTAALLSLGPMDE--QGSLDVSPPYRLRSKRLAVLKTVQ-----------------
--------NHLDFS-SDEMSICD----------------TTMKSACGNSDCANASS----
GVSSIQGK-KLDEHMIGLETLTMNFAHTTKLDA--TQPN------------------L
>gi|145525851|ref|XP_001448742.1|	   585 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
-----MSR--GQIIKYEVD----------------MYEGKSKR-----------------
--------KSD-------KR-------------------KLNQQSPIA------------
-----------------------------------------DYENDKKKVG---------
-RWT------------PEEDEKLQKLI--EEYG---------------------------
----------------------------------------------------E-KSWRII
SDMMEGR-SAIQCL----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------HRWTKILKPG-LKKGPWQDDEDEKLLEWVKNN---GP-C---KWSLCAEN--
-----IA-GRSGKQCRERWFNNLNPNVKKGGWTSEEDHEIFKGYLQYSSS-WSKIA-K-N
LSG-RTENSVKNRFYSTVRKLLADQEKNGISLKML-------------------------
----------------------EAQGENGTSALQTFVKEHLQKYEQQMQLQMEQ------
------------EEPESDKSMQEEKVEESEIKSEDDDDSKSRKKMQAETYQEQN---LLY
RLL-----------------------KQQG-GPIKRT-SCMKDYSTIYKKYKKRYNQKKK
DKKLSDKVENLRKMILK-------------------------------------------
---------KDDYKNSSEEKELDFQQ---NLEQQLANFSQQKIDAQSQNGDSDKMNEFQE
KLLAFFNQQLNEVMKKFYVEMGDPKQAKWQMILASDDNK-----IQQQQQQ--------Q
QQQQQQQQQQQQQQ------------QQQQQQQQQQQLQENKKKTKRQIAKSVKVKEEED
EQKQMV--MNTFLQKFNHLGQIGITQLGYYCQITFRANVNEGKNETENQMVQDGKIDQKM
MFLISQLH-TLE--------NMLGDTKKEFSRLEASLYEKINNTSFHSNNSSE---KN
>gi|14646866|gb|AAK71698.1|AF257483_1	   444 residues, 50 /line  myb transcription factor homolog [Giardia intestinalis]
-----MDR--FLQTPFLID-------------A---------------------------
------------------------------------------------------------
------------------------------------------------ETD---------
-KWR------------VKGLKALYLLV--QELLYAITNSFHAQLSAMSAPSAGSSSNA--
---GEAGSEPSKQFTCPSAASSLDIRLL------EIYRSLFTTCYTSKRMVEAIAVSSQT
QTSTPNG-TDYASS-------EYEVGASSSTI--------------QLSDHSLDSTAFVV
STHPGLGSCASSDSTAFPSQISFDSSPIASELENI------------------------K
VPCDSAQLLSKADVAAINSAILVPPVPPIPIFALAHAGLPYPAQITTSQAPLDRVPISLL
PVTVD-------RPTHKLSGISGIPPGSAIQKSLHTPST--IPMKQEPCIPATRASAPSL
------SAVARQPCSRSH-KETATWSKEEDQLLEIAVGMF---KA-K---NWRKIADFIY
INGHNLP-RRTADQCNQRWLRTIDPKITKGNWPAEEDMQLIAAVKVCPSRNWKAIS-A-L
MPN-RTDVQIRGRLQRLAPMLLERGILTADQ-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------LPPVSSNRGLSAVRS-----L
>gi|147902333|ref|NP_001081768.1|	   624 residues, 50 /line  DNA-binding transcriptional regulator [Xenopus laevis]
------------------M-------------DR--RPSQYSSEEED----------DEI
EMYEHDY-----------------------------------------------------
------------------------------------DGLL-SKGKRHLGKT---------
-RWT------------REEDEKLKKLV--EQNG---------------------------
----------------------------------------------------T-EEWKVI
ASFLPNR-TDVQCQ----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------HRWQKVLNPE-LIKGPWTKEEDQRVIELVHKY---GP-K---RWSVIAKH--
-----LK-GRIGKQCRERWHNHLNPEVKKSSWTEEEDRTIYEAHKRLGNR-WAEIA-K-L
LPG-RTDNAIKNHWNSTMRRKEEQEGYLQNSSKTN--QH-TIVTNFPKSN-HLMTF-THT
RASAE--HSQASTSSFPYYHIAEHQNASYPVALRVNIVNVPQLATAPVQRHYND------
-----------EDPEKEKRIKEL---ELLLMSTENEINQKQELLNHTASYTTCHSTTIGG
NPRLHGQSTPDSCLGDP----HH-STPSPQVDH-SCLPEESASPARYFGVNL--------
----LIQMKNLAEYSETQLIDSFLNTSTQHENLEMEHQSLTSTPICASQKNTITT-SLLR
DHALRLQKENHLLRTPAIK-----------------------------------------
---------------RSILNSTPRTPTPFKNALAAQEFKHGPLKLLHHTPL--------H
LAEDIQEVIKQETDESGIVHDHCNTEEPLLKRIKQEVESPT---HKVGNLYFSSYWEGES
LNAQLFRQQSTLDDTSNSILTSSLLMK---------PVSEKEDHIFKSFPVQS---IKSY
TSPLQHLSGTWDVMSCSRME---------DQKILAEQYC-----KYIKNFS---TLVI
>gi|18858447|ref|NP_571341.1|	   590 residues, 50 /line  transcription factor cmyb [Danio rerio]
------------------M-------------ARRHRHSVYSSDEDD----------DDV
EIYDHDY-----------------------------------------------------
------------------------------------DGPHAKSGKRHLGKS---------
-RWT------------REEDEKLKRLV--EHHG---------------------------
----------------------------------------------------S-EDWKVI
ASFLPNR-TDVQCQ----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------HRWQKVLNPE-LIKGPWTKEEDQRVIELVQKY---GP-K---RWSVIAKH--
-----LK-GRIGKQCRERWHNHLNPEVKKTSWTEEEDQIIYQAHEKLGNR-WAEIA-K-L
LPG-RTDNAIKNHWNSTMRRKVEQEGYLQHAAKVS--PT-PLNNSYSKP--HLLNY-NHT
PSNTS--MPASSMSNQ-YPYYTESSRVPFPLALQLNILNFPQHGTAAIQRHYSD------
-----------EDPEKEKRVKEI---EMLLMSTENELKGQQALPISMNGYGGWNRG----
-------SLADSSVGIV-----V-SVPAPSLEQ-GCLPEESAHGNTNSPNND--------
------SSSTLPEFIDA--IDSFFNASVIPDS-DSQNIPVTPSPVCSQK-------ALQQ
DLALRPQKENELFRTPNLR-----------------------------------------
---------------RSIMECSPRTPTPFKSTLTMQDSKYGPLKRVHSP----------S
LDSGVVGTIKQEPQECEISVGGVHLHQPPLKKIKQEVES------------VCLQWEGQD
LHTQLFPSNGPAHDMPD-LLTSSVLML---------PNTEKTEDGHKAAQLPR----RPI
GIPLQQLN-TWEQVLCGKTE---------EQTIPSEATH-----KYLSNYSSR-ALVI
>gi|47224242|emb|CAG09088.1|	   525 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
------------------M-------------TRRPRNSVYSSEEDE----------EET
EMYEHDY-----------------------------------------------------
------------------------------------DGSLAKAGKRHLGKT---------
-RWT------------REEDEKLKKLV--ELHG---------------------------
----------------------------------------------------S-EDWKLI
ASLLPNR-TDVQCQ----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------HRWQKVLNPE-LIKGPWTKEEDQRVIELVQKY---GA-K---RWSVIAKH--
-----LK-GRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHEKLGNR-WAEIA-K-L
LPG-RTDNAIKNHWNSTMRRKVEQEGYLQGASKGS--SSLSANHSYVKANSNIMAFPHHS
PSHAQ--LPPLSPL--NYAYIADTHRVPLPMAWHLNILNIPQHGTAAIQRHYSE------
-----------EDPEKEQRVKEI---ELLLMSTEDELRGQPSLPMNM-PYLSWASQ----
-------SAMTSSEGVPLVLPHHQAAPALPLEQ-SCLPEESASATRAHSANS--------
-----------------------------RGSSSSHHSSHHSSPAFSN------------
-------------TMPEFM-----------------------------------------
---------------ESVIDSVQNTKHP---------SLHHGVVSLHTHTL--------Q
VGLGPAGGQVRAPQVTAQFLGGGDVCEGRGAGFSHGAE----------------------
---PQVPQHLPQQDTGD-------------------------VDGGGSANRPG----AGR
GVAGDLFV-VVQQSGEAANV---------FIHTCWIWTN-----QRLYMVFIP-FQLF
>gi|21615545|emb|CAD36016.1|	   436 residues, 50 /line  c-myb like protein [Sterkiella histriomuscorum]
-----------MLTNNTMQ-------------RENSSLQRFNSLSST----------SLL
LQVLSKEPKLQIKQEPQTPP-------------------AEGKENVVAPN----------
-----------QLRKPNAIPEVSDNKRQL----QGTTSLLHKLFASQKKKV---------
-EWT------------PFDDAKLLKYV--EKFG---------------------------
----------------------------------------------------D-QKWNKI
SKFMRDR-SEIQCF----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------NRWLELKDTCFVSKGPWTKEEDEILRQMVETH---GP-R---NWSTIAAA--
-----LP-GRIGKQCRERWHNHLDPNIKKEKWSPEEDRIILKMHLEMGNR-WCEIA-K-L
LPG-RTDNAIKNRFNSKLKKQISRQSNFAASQQLDI---------------------IQS
PSNKV--QTPSSPMS-----IEQQILFHLKKRDKKGLIKIIQQNQAIARRQLSL------
-----------------------QSTASSGITMTPQSTLN--------------------
-----------TTKKSDSNETFTL--------------------------------KSQS
AFTKVLQGQKLEQISSNEDSHTFNSTSE--------SQMQLPSPANQD------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------QNSLIFQNTVNHNQ--------------
-------------------------------------SNQQDNLEVKLATRKIQFN----
--------------------------------------SYICIPSFPSAFYKQ-VKIS
>gi|25453366|gb|AAL25935.2|	   530 residues, 50 /line  MYB [Giardia intestinalis]
------------------------------------------------------------
-----------MLPVPSQPSTPKRVPQ------------PTPPQCVHSPF----------
-----------AQGYVAVSSPFSKNYPVD----HFNDDLLH-------------------
---------------------VFKARI--SPCYVAPAGPFRSPMVATAQKVYDVNASEHP
HYNGYYITHCSGQLSSPSLSYSFKESISFGGHGVVYSPPALTPMPSSYSSAGMPNDKGVI
THDPMET-GSTVLSTKYPLFEEYGDSKESVIHVDQLNSPIKNIARSQVDISYDDPQNFFG
ATCHDYGEYYHPHSEFFHDDVNCNPVYCGQSKPIQSHDLQEDTGHCSYSCTSYDTGDVSL
PSANGSSTLSSFTTCSSGSNELGCRDSTHAHKVHGQSQRAYPLPQSYTDGPIIDERIRAV
PTHPNDAKRGKTRPKQDLASACSKSKKMPTSGSLHMPANDQSDAYRPPGPPEATEDDRGT
DGYAESDSSTTDYYVIRR-KPCTNWAPEEDEALIKVVAAL---GT-R---NWKNVARLVH
RECPHLP-ERSADQCSQHWLRVLDPSIVKGKWTPEDDNALIEAVKLCPPRQWKMIA-N-Y
VKG-RTDIQVRYRMKRLAKTLLKRNILPR-------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------EKLP
>gi|45357116|gb|AAS58517.1|	   437 residues, 50 /line  MYB transcription factor [Arabidopsis thaliana]
-----MEFESVFKMHYPYL-------------AAVIYDDSSTLKDFH----------PSL
TDDFSCVHN--VHHKPSMPHTYEIPSKETIRGITPSPCTEAFGACFHGTSNDHVFFGMAY
TTPPTIEPNVSHVSHDNTMWENDQNQGFIFGTESTLNQAMADSNQFNMPKP---------
-LLS------------ANEDTIMNRRQ--NNQV---------------------------
--------------------------------------------------------MIKT
EQIKKKN-KRFQMR----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------RICKPTKKAS-IIKGQWTPEEDKLLVQLVDLH---GT-K---KWSQIAKM--
-----LQ-GRVGKQCRERWHNHLRPDIKKDGWTEEEDIILIKAHKEIGNR-WAEIA-R-K
LPG-RTENTIKNHWNATKRRQHSRRTKGKDEIS--LSLGSNTLQNYIRS------VTYND
D-----------------------------------------------------------
------------------------------------------------PFMTANANANIG
PRNMRGK-----------------------------------------------------
GKNVMVAVSEYDEGECKYIVDGVNNLGLEDGRIKMPS-----------------------
------------------------------------------LAAMSASGSASTSG----
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------SAS
GSGSGVTM-EIDEPMTDSWMVMHGCDEVMMNEIALLEMI-------------A-HGRL
>gi|462671|sp|P34127|MYBH_DICDI	   451 residues, 50 /line  Myb-like protein
MQPKRMSHNL--TVGEKAGSPFNVILNAANNTNSDNSSNNSDNENDD----------NQN
NNNNNNNNNNNNNEEEEEEDDDDDDDSQQNRHNISIPFTINK----NSINNNNNLINNIN
NNINNMNNNMNNNNNNNNMNNNINNNG-----NSNISNNNTPKVEKKKTKG---------
-KWT------------SEEDQILIKAV--NLHN---------------------------
----------------------------------------------------Q-KNWKKI
AEHFPDR-TDVQCH----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------HRYQKVLHPN-LVKGAWTKDEDDKVIELVKTY---GP-K---KWSDIALH--
-----LK-GRMGKQCRERWHNHLNPNIKKEAWSDEEDQIIRDQHAIHGNK-WAEIA-K-F
LPG-RTDNAIKNHWNSSMKRVSNNNVHLKSHAI-EHSLSSQDNQDS---PKSIITSS-SP
IPTTT--TTTTTTSTT-LITPPPPPLLPPPPSINKKEKKFKQ------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------PKKRNASEI-EQTLSQPHIN-----QHESSPIVF-------
---------------ENISNGNNKIDIP-----AAQYLMTNGIS----------------
------------------------------------------------------------
------------------------------------------------------------
----------------CINNNNNNNNNNN--------------NNNNNNNNNN---NN
>gi|67542021|ref|XP_664778.1|	   305 residues, 50 /line  hypothetical protein AN7174.2 [Aspergillus nidulans FGSC A4]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MTEPRR---------
-RWT------------AAEDALLWDLY--QVQEKAPTGKCQ-------------------
----------------------------------------------------K-INWNEI
ARHIPGR-TNKDCR----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------KRYYNRFTGG-LRKGSWTQEEDERLFRLVERY---QY-----RWATIAQK--
-----ME-TRNADQCSKRWHHCLNPELERSPWTVDENMLLLSAVNTHGSS-WKDIQ-KCH
FPT-RSANNIKNQYTILSRKNISLAPAHLHPCCD--SPSPSKSSR---------------
-------RPPSTPT----------------------------------------------
---------STPQVPGSRQGSSYDPYDYGSLSSTPQLSATDYL-----------------
--------------------PATPEAPAVNFDM---------------AMGA--------
-----------------------------FGDSCGYMPQYQPSPSFYAN---------SP
DGSELMMPETMG------------------------------------------------
------------------------------------------------------------
---------------------------------------------MRMRYDFRDGLEQEG
VR----------------------------------------------------------
----------------------------------------------YPGQETF---GY
>gi|86440317|gb|ABC96071.1|	   342 residues, 50 /line  EMYB3 [Euplotes aediculatus]
-----MSD--CSMSLLSVNNSI-------------MFESSNTSVNGR----------PSK
VCARSAFNNI--------------------------------------------------
------------------------------------------------------------
-DCG------------KEKNEQLTSLN--SHRI---------------------------
-----------------------------------------------------SKSKYCE
NADFKGC-SQPKIY----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------KTSHKLSTSR-IVKGPWTEEEDEIVMKMVNKY---GP-R---NWSQIASA--
-----LS-GRVGKQCRERWHNHLNPNIKRAKWTEEEDRIILTEHNKVGNR-WAEIA-R-L
LPG-RTDNSIKNHFNSTLKRKMAKECLKKNDLNTY---QETACDSFGEDNKF--------
------------------------------------------------------------
---------------ESPVNFKTSES----------------------------------
----SHLSTVDRILETQNDDCFL-------------------------------------
------------------------------------------------------------
----------------------SMLASKLNDSLARIKL----------------------
-----PKQTDQCPFK--LLNSPQNIIADFSNYHRPKPVKRVPLKIL--------------
---------------------------------------------ENSIGFHSKLTEAKD
D-----------------------------------------------------------
-VKMSLNS-AFEQVFQDKED----------------------------------FIMA
>gi|116192773|ref|XP_001222199.1|	   390 residues, 50 /line  hypothetical protein CHGG_06104 [Chaetomium globosum CBS 148.51]
MASSR---------------------------------TLISSP----------------
------------------------------------------------------------
------------------------------------------------------------
----------------PDSPVAGQKPR--QKDG---------------------------
----------------------------------------------------P-ISWHKV
ACHLPGR-NNKDCR----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------KRWHYSIANT-IRKGTWMREEDERLREAVELY---GT-R----WSKIAEA--
-----VG-TRNGDQCWKRWYDCLDPRIDKSPWTPEEDALLLHLVSQTGRN-WSDIVHQ-H
FPA-RTSLAAKNRYSILRRKQ-DGLPTSTSTSRGS----SSVRHAKARTPGGVSRSPAPA
PATPSLS-------SSPYLGVVATPS----------------------------------
----------------------------------------------TTALSTPEPEVLGG
GGGGGGV-QGGDWMAL----------AAAEIDEML----------------YRGAQGMGI
GGGELDLDME----LELDLDRGFGGL------STGWVQQQQPQGYQYQGLDSCQQAGGFD
------------------------------------------------------------
---------------ASLVDPRMQQEGYG-------------------------------
NGEYYAAQGQQQLGVGGYGYDGSNML----------------------------------
----------------------GVYQGGVQIQVTQP------------------------
----------------GMYDGSSGLVGQSQMGS------------WQGGYAAG---GW
>gi|116500363|gb|EAU83258.1|	   391 residues, 50 /line  hypothetical protein CC1G_11894 [Coprinopsis cinerea okayama7#130]
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MLCRERR---------
-SWT------------AKEDQLLREAV--NKEDPNNPN----------------------
----------------------------------------------------P-SKWHAI
AKHVPNR-TNKDCR----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------KRWFAKMASD-VVKGGWSPEEDERLVKGIERY---GT-R----WSLVASV--
-----VQ-TRNSDQCAKRWTDTLNPAIDRTTWTSEADEILLRAVEEHGKV-WTKIV-KTY
FPG-RTGLSAKNRYNSITRFNH-DNGRGARSRRKSES--VDGGYFSTSKTESVSSSSSAS
PTTPSLGLPMGSP----------------PMSFSLTGAHLPPYDSL--------------
------------------------------------------------------------
---------------SGWQSPSSI-------------VSDDLSPIQGYGRNVPSSGS---
---------------------------SNASSDSSYQSVDLSMPALTPTEMGQS------
------------------------------------------------------------
-------------------------LAVYGNGTLLQGGDYFKASSTSSPRIVEHNNFLSS
QAASDPIPSTYSQYPAIYNGNSSDLNNHFSSLDTMPNHID-----SLGNISWDSSLSSAA
LEVKLKRSPS--------------------------------------------------
----------------------------------------------------EFTYMY
>gi|116831373|gb|ABK28639.1|	   428 residues, 50 /line  unknown [Arabidopsis thaliana]
MENFV---DENGFASLNQNIFTRDQEHMKEE---DFPFEVVDQSKPTSFLQDFHHLDHDH
QFDHHHHHGSS--------------------SSHPLLSVQTTSSCINNAPFEHCSYQENM
VDFYETKPNLMNHHHFQAVENSYFTRNHHHHQEINLVDEHDDPMDLEQN--NMMMMRMIP
FDYPPTETFKPMNFVMPDEISCVSADN--DCYR---------------------------
-----------------------------------------------------ATSFNKT
KPFLTRKLSSSSSS----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------SSWKETKKST-LVKGQWTAEEDRVLIQLVEKY---GL-R---KWSHIAQV--
-----LP-GRIGKQCRERWHNHLRPDIKKETWSEEEDRVLIEFHKEIGNK-WAEIA-K-R
LPG-RTENSIKNHWNATKRRQFSKRKCRSKYPR------PSLLQDYIKS------LN---
---------------------------------------MGALMASSVPARGRR------
-----------RESNNKKKDVVV---AVEEKKKEEEVYGQDRI-----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------VPECVF---TDDFGFNEKLLEEGC
SIDS--------------------------------------------------------
---------LLDDIPQPDIDAFVHGL-------------------------------G
>gi|119189279|ref|XP_001245246.1|	   418 residues, 50 /line  predicted protein [Coccidioides immitis RS]
MESKR--------GTRYSS-------------PTSLLNPQVLSINPQ----------PGD
FCFTRFG-----------------------------------------------------
------------------------------------DAGNAKNLLGGSGRNAGYREEKRG
IRIP------------RPETVALSILLPGTEGG---------------------------
----------------------------------------------------T-KNWNAI
AEKLPGR-TNKDCR----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------KRWHK-IGPN-IKKGVWTPEEDARLQEAVSLF---GL-KLFGRWTRVAEF--
-----VG-SRNADQCSKRWAYALDPSLSHTPWTEEQDQLLLMVVNKFGHN-WSKIS-S-T
AFGDRSTSDIKNRYFTLQRRKRNTSVSNTV------------------------------
------------------------------------------------------AYQIDD
ENHSDLGWPESGALPEPPRNAL------LDVGTTPSLDSSSET-----------------
------------------------------------------------------------
-----------------PVSIDYLLENTDI------------------------------
----AQLSEMNGLSNTSISPYEDVTSKDA-------------------------------
------MADPDPDFRKFLHHFDPSQAADFDGGNWDAD-----------------------
-------------SHLRAVTGGSFGREETNHANNGEWPDS--------------------
-------------------------------------------SHIASTNPTETDTGSQS
CTSTLVLE------------------EMEPQTVTLVLSTLLSSNSRFRMRIDN----N
>gi|121913155|gb|EAY17968.1|	   182 residues, 50 /line  Myb-like DNA-binding domain containing protein [Trichomonas vaginalis G3]
-------------------------------MQTSMSNETATADQTG----------GGF
YSFPD-----------------QYQPYPADAQGT--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------GTPNLS
QQYAAMQ-LFPQYL----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------MDSAPMNNAA-SSRGAWTAEEDAQLKAAITSI---GP-K---KWHDIAKF--
-----VP-TRTSKQCRERWLNCLDPNIKKGAFEPWEDQLIIEKQREIGNH-WSNIA-R-L
LPG-RSPGAVKNRWYSGLKNFHQAD-----------------------------------
---------------------------------QLNTLILPQE-----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------
>gi|121917330|gb|EAY22105.1|	   255 residues, 50 /line  Myb-like DNA-binding domain containing protein [Trichomonas vaginalis G3]
--------------------------------------MALAPTRS--------------
------------------------------------------------------------
----------------------------------------RKQRSYSSVAA---------
-VWT------------PEEDELLTNLV--SKST---------------------------
----------------------------------------------------N-IKWTEI
AKSFPNK-TAPQVS----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------GRWIKALKPD-LVKGSWTREEDEKIFEFIREH---GD-R---DWSKLAAL--
-----LP-GRIGKQCRERWINHLNPAIKHASWTEEEDNLLITLHEQFGNS-WAKIA-K-Y
FNG-RTDNCVKNRWNSTLKRRLERMARGEPALK-KRGRKPKNAQQ----TDICMDIPSPA
SAGLT--LPP--------------------------------------------------
--------------------------------------GQEIMPLSI-------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------PLLSVLPPLMQKNP---------HPTTLAEN
RLSLK-------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------QLLNYP------E
>gi|121917905|gb|EAY22676.1|	   295 residues, 50 /line  Myb-like DNA-binding domain containing protein [Trichomonas vaginalis G3]
------------------------------------METALAPTRQ--------------
------------------------------------------------------------
----------------------------------------RQKAVSRTHNN---------
-KWS------------AEDDALLQKLM--TEEP---------------------------
----------------------------------------------------T-DNWPSL
LPYFPGK-TATQIG----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------ERWCKVLDPK-LIKGSWTREEDEMIIKFVQEN---GT-K---NWKKLAEI--
-----LP-GRLGKQCRERWRNHLDPNVNRSPWTPEEDKLLIQLHEKYGNQ-WVKIS-E-M
FNG-RSDNCVKNRWNSTLKKQILYDQLGI-------------------------------
------------------------------------------------------QRPKRG
RPSLQKMPKSADDIPKPPKLEEIA------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------AEIQNEPKP---PATPTLASSLQTPVFSPFLKSPFP---------QPSPSLDK
DVTPMQW-----------------------------------------------------
--------------------------SPSLREDQFSLSPNLI------------------
------------------------------------------------------------
-----------FNGLSLFSPKLPSNPNNN--------------------------ISL
>gi|123319115|ref|XP_001293143.1|	   341 residues, 50 /line  Myb-like DNA-binding domain containing protein [Trichomonas vaginalis G3]
-----MSRSS--------------------------GLSSKAPTRA--------------
------------------------------------------------------------
----------------------------------------RTRVSTKTSQT---------
-TWT------------EEEDNILSQLM--ENEK---------------------------
----------------------------------------------------I-ANPEIF
AKKFPNK-TQQQVM----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------DRWNKVLNPE-LIKGSWTTEEDEIITQWVNEH---GA-R---NWSSLAAT--
-----LP-GRLGKQCRERWVNNLSPDLVHQPWSAEEDKILIEHQQKWGNK-WAKIA-Q-L
LPG-RTDNSVKNRWNSSLKRKLERIARGEAPVN----KRGRKPKRASNAPDVAP------
-------------------IIESKSSISISIPEPENLEDIPNHDSTE-------------
---DEKPKITSEKEDKSPSQDESS------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------KEIPKPDLAGV-DLSIPSPAIQTPLL---------------MS
PFMQM-------------------------SPILMKDSPFFPLWSPGSNSD--------L
K-----------------------------------------------------------
--PSTILKSPLPFS-LDKNEALD-------------------------------------
-------------------------TNKATD----------------------LKFFS
>gi|123402486|ref|XP_001302061.1|	   188 residues, 50 /line  Myb-like DNA-binding domain containing protein [Trichomonas vaginalis G3]
---------------MNIEYPSNATDYAGQQT-SQHFPSQTKSEEND----------DQH
KPTSADF-----------------------------------------------------
------------------------------------LGFNVHF-----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----GDQLEPQQTSGSR-ARAKRWTPEEDQKLRDAITQH---GT-T---NWQAVATM--
-----VGNGRARSQCSQRWNRVLNPEISKANWSKEEEQILIKSVEQYGNKAWTRVA-Q-Q
LGN-RTDVQCRFKYRYLMKKFDQANALAAQEQPQQMPKETDTV-----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------
>gi|123404044|ref|XP_001302354.1|	   167 residues, 50 /line  Myb-like DNA-binding domain containing protein [Trichomonas vaginalis G3]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MDFDDLN-LSRTKFSAAEDELLRKTVQKY---GA-K---KWNTIAQH--
-----LP-GRTARQCRDRFQNYLSPDLTNGPWSHEEDLLLLEKVDEYGSC-WSKIN-K-F
FDG-RSPNNIKNRYNTHLAKSKYHSKKHLKKVAP--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------SIKKEEENECDVI--------------------------KFDAVVTAKLWE---
------------------------------------------------------------
---------------------------------------AFNSQDYFSNNLDLLFIFD
>gi|123416631|ref|XP_001304935.1|	   236 residues, 50 /line  Myb-like DNA-binding domain containing protein [Trichomonas vaginalis G3]
---------------------------------------------MD----------DQN
NFFDFDNGANMDLNDPF---QQQQEPQEPTPQVSPAPS----------------------
----------------------------------------AKPQKVAHG-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------KNMWTPEEDQKLLAAVEMFQINGQIK---NWSQVAAM--
-----VP-GRNNSQCSARYKNVLHPALQKSDWTQEELDKLNQLFPILGKS-YTLYQ-E-R
LPG-RSYQQIKNKVQSLINKKNSKRKSNPPPTN--------VVTDP-----RMMFF-SQQ
PSPNA--FSQSSQGN---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------LSFSPGAFSQGHFDFSASTISG--------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------SDT
SAFSLTDQ---------EVDPVFDQFW------------------------------E
>gi|123440110|ref|XP_001310819.1|	   206 residues, 50 /line  Myb-like DNA-binding domain containing protein [Trichomonas vaginalis G3]
MDDTE-------------------------------------------------------
------------------------------------------------------------
-DDPLLEPSLSINDSTFMME----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------NGSTSNDVKNVFREMFQSK---------
------------------------------------------------------------
------------------------------------------------------------
---------------------TLIPTEIQNKQNIRTEIS--IDSNQMNENAFTRESQNLY
------FSQFPRHDEKSR-NKSRSWTPEEDNRLIEAVNKY---GS-S---EWCKIAQY--
-----VGNGRTRSQCGQRWNRVLSPQISKDPWTPEEDQKLANLVCLYGDRTWSKIA-N-E
MGS-RSDVQCRYRWKRTLKAAITKVVTKSK------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------
>gi|123450002|ref|XP_001313698.1|	   243 residues, 50 /line  Myb-like DNA-binding domain containing protein [Trichomonas vaginalis G3]
-----MIRQH--------------------------------------------------
------------------------------------------------------------
FPEPIIPN-----------------YPVSKSTSS--------------------------
----------------------------------------------------SINYENQS
QKSSYLL-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---TYYQNTSLESAFPSA-LSNGTWTPEEDQKVIDWVKEH---GP-T---NWTKLAEL--
-----IP-GRAGKQCRERWHNNLDPHLVKSSWTPEEDRIIIQLQKELGNK-WAKIA-E-H
LPG-RTDNAVKNRWNSALKRRLAPDYVKGKVHKPAPQPQP-AKADPLKI------MMLNP
IA-------------------------------DLSVISFNQQNQ---------------
---------------------NSSPIECIDVSDEPFLGFDEPISTNL-------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------DLNESSTDIYDF----------------------QLDL
>gi|123471389|ref|XP_001318894.1|	   179 residues, 50 /line  Myb-like DNA-binding domain containing protein [Trichomonas vaginalis G3]
-------------------------------MTGYE------------------------
------------------------------------------------------------
-------------------------------------------------KG---------
-PVI------------PPHD----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MQNNMEPIN-------
---------------------------------------------TLPGIP---------
-EYPMEYNPQSVQVNLKA-AKKQKFTPEEDEMLKRAVAQH---GS-----DWKMIAAT--
-----FP-NRNARQCRDRWKNYLAPSISHTPWTAEEDALLVQKIQEYGRQ-WAIIA-K-F
FPG-RTDIHIKNRWVTISNKLGIPQTQQMQV-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------DPNEIIPGVTIIDNMMKQESQ--------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------
>gi|86440321|gb|ABC96073.1|	   177 residues, 50 /line  EMYB5 [Euplotes aediculatus]
--------------------------------------MEHYEEESY----------EDS
EYYDEESEG---------------------------------------------------
------------------------------------GSKKSKENKGNVKAG---------
-KWT------------EAEDELLRRTI--QEHG---------------------------
----------------------------------------------------A-KNWKQI
CRYVPGR-TSIQCL----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------HRWTKILKPG-LIKGPWNIKEDKLLREWVMEN---GP-S---RWSEATKV--
-----IT-GRSGKQIRERWFNTLNPTLKKGNWSSEEEQVLIKLVMLFGSK-WSKLV-R-F
FSG-RTENSIK-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------
>gi|123496604|ref|XP_001327001.1|	   169 residues, 50 /line  Myb-like DNA-binding domain containing protein [Trichomonas vaginalis G3]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------MIRGASR-------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------YVTSKFTQEDDNRLKKLVSKY---GT-D---SWREVSKY--
-----FP-YRNERQCRDRWEKFLCPSLNKGPFTEEEDMTIMRLHAELGPK-WMTIS-R-L
MNN-RSDVSIKSRYNSLMKRINTQKNSSFAQKSENISPKIATE-----------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------ACIPEVS-------------------
----------------NEISDPILNFDE--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------KSRQLFDTEDFFND-----FIIF

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.