FANDOM



>gi|18397344|ref|NP_565359.1|	   456 residues, 50 /line  ALD1 (AGD2-LIKE DEFENSE RESPONSE PROTEIN1); transaminase [Arabidopsis thaliana]
-----------------------------------------MVSLMFFSSASPLCSSPSK
IPKASLDFEMKKLGGS---------TKLVRNVNLEKLK--NNYLFPEINRRELEHIEKHP
NVQLISLGTGDTTEPIPEQITSHMSNFAHGLSTVEGYRGYGLEQGNKTLRKAIAETFY--
RDLH-VKSN-EVFVSDGAQSDIS-RLQL-LLGSNVTIAVQDPTFPAYIDSSVIIGQTGHF
HEKTKKYQNVVYMPCGPNNSFFPDLAMT-----PRTDVIFFCSPNNPTGYVASRKQLHQL
VDFAKTNGSIIIFDSAYAAFIEDG---S-PRSIYEIPGAREVAIEVSSFSKFAGFTGVRL
GWSIIPDELLYSNG----FPIINDFHRIVTTSFNGASNIAQAGGLACLS-SGGLKEIRSV
NNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFK----GSKSWDVF-------NEILE
NTHIITVPGSGFGPGGEEYLRISGFGR---RDHIVEASKRLQNF---FNTRTKHFTY---
--------LSSTSNTN
>gi|107103814|ref|ZP_01367732.1|	   411 residues, 50 /line  hypothetical protein PaerPA_01004885 [Pseudomonas aeruginosa PACS2]
-----------------------------------------MAESR--------------
-----------------------------PARRFARIDRLPPYVFNITAELKMA--ARRR
GEDIIDLSMGNPDGPTPPHIVEKLCTV----AQREDTHGYSTSRGIPRLRRAISHWYRDR
YDVQ-IDPESEAIVTIGSKEGLA-HLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRS
---VPLVPGIDFFN-ELERAIRESIP--------KPRMMILGFPSNPTAQCVELDFFERV
VALAKQYDVMVVHDLAYADIVYDG---WKAPSIMQVPGAKDIAVEFFTLSKSYNMAGWRI
GFMV-----------GNPELVSAL-ARIKSYHDYGTFTPLQVAAIAALE-GD-QQCVRDI
ARQYQQRRDVLVKGLREAGWMVENPKASMYVWAKIPEPYTHLGSLEFA-------KKLLQ
DAKVSVSPGIGFGDYGDDHVRFALIEN---RDRLRQAVRGIKSM---FRADG--------
---LLSPQKKVDSLAE
>gi|121542099|ref|ZP_01673837.1|	   409 residues, 50 /line  aspartate aminotransferase related protein [Candidatus Desulfococcus oleovorans Hxd3]
-----------------------------------------MIK----------------
-----------------------------INEHFLKLQ--SSYLFSEIAKRVNAHQATHP
DQSIIKLGIGDATQPLCPACLDAFHKAVDEMGTASSFRGYGPEQGYAFLREAVAANDYQA
RGAD-IQPD-EVFISDGAKCDTG-NFQE-LFATDIRVAIPDPVYPVYLDTNVMAGRTGAF
--ENGRYGNIVYMECTAQNSFLPAIPK------EPADLVYLCFPNNPTGAVATKEYLQAW
VDWALDAKALILFDAAYEAFIRDP---SIPKTIYEIPGARKVAVEFRSFSKTAGFTGTRC
AFSVVPKECMAYDTSGKAHALHALWNRRHCTKFNGVSYPVQRAAEAVYS-PEGKAQAKEM
IRTYMANADRITAAMAGMGFSYVGGDHSPYIWVDTK-----TDSWAFF-------DTLLT
KAGVVCTPGGGFGKCGAQYIRLSAFNS---YANVDAAMKRMAEV---FGK----------
---------------A
>gi|51246017|ref|YP_065901.1|	   421 residues, 50 /line  aspartate aminotransferase [Desulfotalea psychrophila LSv54]
-------MPSYIKYKTPFSNLSGNNHC-------KKTLEDDMIT----------------
-----------------------------INENYLKLQ--ASYLFSDIAKRVATFQEENP
EKEVIKLGIGDVTRGLTPSVIAAFHQAVDEMANDSTFHGYGPEQGYAFLREAIAENDFQS
RGAG-IVAD-EIFVSDGAKCDTS-NIQE-IFSAETKIAIPDPVYPVYLDTNVMAGRTGLF
--ADGRYQNIVYLDSTKENNFVPELPT------EKVDLIYLCFPNNPTGSTITKAGLKRW
VDYAIENKALILFDAAYEAFIQDD---TLPKSIYEIEGADKVAIEFRSFSKNAGFTGTRC
AYTVVPKACMAYDSEGNSHSLHSMWNRRHCTKFNGVSYPIQRAAAATYT-PEGKAECKEL
IDYYMANAKVVCQTMTSWATPMWAEKTLPI-----------------------------S
GLMVKQIPGSSL-ICSSARRGLSVPRE---QDLAPAEMAIFAFPPSTARK----------
---------------I
>gi|150006985|ref|YP_001301728.1|	   409 residues, 50 /line  aspartate aminotransferase [Parabacteroides distasonis ATCC 8503]
-----------------------------------------MAL----------------
-----------------------------INEHFLKLQ--NNYLFSDIAKKVNSFKVTHP
KDKIIRMGIGDVTQPLAPAVIEAMHKAVEEMASKDTFHGYGPEQGYPFLIDAIIKNDYAS
RGVF-IEPS-EVFISDGAKSDCG-NIGD-MLRHDNSIGVTDPVYPVYIDSNVMSGRTGVL
--ENGKWSDVVYIPCTAENNFVPDLPS------RRVDILYLCYPNNPTGTTLTKDELKKW
VNYALANDVLIMYDSAYEAYIQDP---NIPHSIYEIKGAKKVAIEFRSFSKTAGFTGIRC
GYTVVPKELNAFTLDGQRVQLNKLWNRRQCTKFNGTSYITQRGAEAVYS-TAGKQQVTAT
INYYMTNAKIMKEGLQNCGLTVYGGDNAPYLWLKTPDG---LSSWKFF-------DKLLY
EVKIVGTPGVGFGPSGEGYLRLTAFGD---RDDTLEAMARLRKW---LR-----------
----------------
>gi|60682142|ref|YP_212286.1|	   410 residues, 50 /line  aspartate aminotransferase [Bacteroides fragilis NCTC 9343]
-----------------------------------------MAL----------------
-----------------------------VNEHFLKLP--GSYLFSDIAKKVNTFKITHP
KRDIIRLGIGDVTRPLPKACIEAMHKAVEEMTSAETFRGYGPEQGYDFLIEAIIKNDYAP
RGIH-LSPT-EVFVNDGAKSDTG-NIGD-ILRHDNSVGVTDPIYPVYIDSNVMCGRAGVL
DTESGKWSNVTYMPCTAENHFIPAIPE------KRIDIVYLCYPNNPTGTTLTKAELKKW
VDYALANDTLILFDAAYEAYIREP---DIPHSIYEIKGAKKCAIEFRSFSKTAGFTGVRC
GYTVVPKELTAATLEGERIPLNRLWNRRQCTKFNGTSYITQRAAEAIYT-PEGKEQIQET
INYYMTNARIMKEGLESTGLKVYGGVNAPYLWVKTPKG---TSSWRFF-------DQMLY
EANVVGTPGVGFGPSGEGYIRLTAFGE---RDDCIEAMRRIKNR---L------------
----------------
>gi|115451309|ref|NP_001049255.1|	   440 residues, 50 /line  Os03g0195100 [Oryza sativa (japonica cultivar-group)]
---MPVNMISKLLEKAVLPALDVAPPVKIGGPR------RTSVL----------------
-----------------------------RNPNMEKLQ--KGYLFPEISIKREEHLKKYP
DAKVISLGIGDTTEPIPSIVTSAMAEYALALSTPEGYQGYGPEQGHKNLRKEIADKVYPD
MG---IKES-EVFISDGAQCDIA-RLQT-LFGPNVTIAVQDPTFPGYVDNGVIMGQTGKA
DD-GGRYAGIEYMRCAPENAFFPDLSRV-----RRTDVIFFCSPNNPTGHAASREQLRQL
VELARRNGSIIVFDSAYSSYISSSSSSSTPRSIYEIPGAREVAIEVSSFSKFAGFTGVRL
GWAVVPDELLYSDG----VPVARDFDRVVCTCFNGASGIAQAGGVACLSTEEGRGAVARV
VGVYRENARVLVETFRSLGKEVHGGGDAPYVWVRFP----GRRSWDVF-------AEILE
KTHVITVPGSGFGPGGEGFIRVSAFNS---RDKVLEACQRLKSF---LA-----------
----------------
>gi|125603687|gb|EAZ43012.1|	   439 residues, 50 /line  hypothetical protein OsJ_026495 [Oryza sativa (japonica cultivar-group)]
------MAASPAAGAAAATVSSFVSPSSFSSVNFRFEAFKTKVP----------------
-----------------------------RNANMAKLQ--AGYLFPEIARRRAAHLLKFP
DAKIISLGIGDTTEPIPDVITNAMAKRAHALSTVDGYSGYGAEQGEKKLRAAIAATYYAD
LG---IEET-DIFVSDGAKCDIS-RLQV-LFGSNVKIAVQDPSYPAYVDSSVIMGQTGLY
QEDVQKYGNIEYMKCSPENGFFPDLSSV-----PRTDIIFFCSPNNPTGAAASRDQLTKL
VKFAKDNGSIIVYDSAYAMYISDDS----PKSIFEIPGAKEVAIETASFSKYAGFTGVRL
GWTVVPKELLFSDG----HPVAKDFNRIVCTCFNGASNISQAGGLGCLS-PEGLKAMSDV
VGFYKENTKIIVDTFTSLGFNVYGAKNAPYVWVHFP----GRNSWDVF-------AEILE
KAHVVTTPGSGFGPGGEGFVRVSAFGH---RENIIEAARRLKQL---YK-----------
----------------
>gi|146270973|gb|ABQ17964.1|	   432 residues, 50 /line  LL-diaminopimelate aminotransferase [synthetic construct]
------------MAKRVNTCKCVATPQE-KIE------YKTKVS----------------
-----------------------------RNSNMSKLQ--AGYLFPEIARRRSAHLLKYP
DAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGG
LG---IGDD-DVFVSDGAKCDIS-RLQV-MFGSNVTIAVQDPSYPAYVDSSVIMGQTGQF
NTDVQKYGNIEYMRCTPENGFFPDLSTV-----GRTDIIFFCSPNNPTGAAATREQLTQL
VEFAKKNGSIIVYDSAYAMYMSDDN----PRSIFEIPGAEEVAMETASFSKYAGFTGVRL
GWTVIPKKLLYSDG----FPVAKDFNRIICTCFNGASNISQAGALACLT-PEGLEAMHKV
IGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFP----NQSSWDVF-------AEILE
KTHVVTTPGSGFGPGGEGFVRVSAFGH---RENILEACRRFKQL---YKHHHHH------
---------------H
>gi|116328950|ref|YP_798670.1|	   408 residues, 50 /line  Aspartate/tyrosine/aromatic aminotransferase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
-----------------------------------------MAN----------------
-----------------------------INENYLKLK--AGYLFPEISKRVKTYSEKNP
SAKIIRLGIGDVTLPIVPSVVDAMIAASKEMGTAGGFHGYGPEQGYSFLLKSIANNDYGS
LGIK-IDE-SEIFVSDGSKCDCG-NIQE-IFSTDAKIAVSDPVYPVYVDTNVMAGRTGEI
GA-DGRYSNLIYMPATKENGFQPEIPK------EKADIIYLCYPNNPTGTVTTKKALRAW
VEYAKKNNSIILYDSAYEAFISEP---GVPRSIYEVAGAKEVAIEFRSFSKTAGFTGLRC
AYIVIPKELKGRTRGGEEVSINSLWSRRHTTKFNGVSYVTQKGAEACYS-PQGKKEIQAS
IAYYMSNAAKIREGLKKAGYEVFGGVNAPYIWLKTSDN---LSSWDFF-------DRLLD
KAQVVGTPGSGFGPAGEGYFRLSAFGK---KEDVEEAIARISFL----------------
----------------
>gi|117925052|ref|YP_865669.1|	   421 residues, 50 /line  aminotransferase, class I and II [Magnetococcus sp. MC-1]
-----MTETAPFMGVGWLCRLSSCMNGP---------S----------------------
------------------------------MEEFHRIKRLPPYVFAVVNEL--KYKARNR
GEDIIDFGMGNPDQPTPKHITDKLIEAVQD----GRNHRYSLSRGIGGLRRAVCAYYKRR
FGVD-LDPESEAIVTIGSKEGLS-SLAMAITEPGMNVIVPSPTYPIHEYSFLIAGAHIQR
------------VKISRDNDFIEDMKVAVRNHWPRAQVLVVNFPSNPTAQVVELDFYQKV
IDFAKEHNIWVISDVAYAEICFDG---YKAPSILQIPGAKDIAVEFYSLSKTYNMPGWRV
GFCV-----------GNPHLIKAL-SRIKSYLDYGMFQPIQIAATVALN-GP-QDCVAEI
NEIYRQRRNVLIDGLARAGWAIERPKASMFVWAEIPDEFKAMGSLEFS-------KLLLK
EAKVAVSPGVGFGVYGDDHVRIALIEN---EHRTRQALRSMRRF---LSAGS--------
-----------DVAGD
>gi|147679184|ref|YP_001213399.1|	   416 residues, 50 /line  aspartate/tyrosine/aromatic aminotransferase [Pelotomaculum thermopropionicum SI]
------------MKTGINW-----------------------------------------
--------------------------QSRINPVVREIP--SSGI-------RRFFDLAAE
MKGVISLGVGEPDFVTPWHIREACMYSLE-----KGYTMYTSNQGLLELREEIARDLAES
YGVI-YDPRSEILITVGVSEGLDLALRT-VVCPGDEVLIPDPSYVSYAPCASLAGARP--
----------VYLPTSVENGFQVTAEMVEKAVTPKTKALVMCYPNNPTGATIDRQLLMEI
AEVVKYHDLIVISDEIYDKLTYVG---E-HTCMSSLPGMRDRTILLNGFSKAYAMTGWRV
GYAA-----------GNGDFIAAM-KKIHQYTMLCAPITAQVAAVEAL--KNGKPGMKKM
VEHYNRRRRLVLQAFQEIGLPCFEPRGAFYAFPDIR--VTGLSSEEFA-------RQLLQ
EEKVAVVPGSAFGVQGEGYVRCSYAAS---VEELSEAFKRMNSF---VGRRVNRGKILTI
AFGKNGQKKEGICQSI
>gi|150384011|ref|ZP_01922720.1|	   411 residues, 50 /line  aminotransferase, class I and II [Victivallis vadensis ATCC BAA-548]
-----------------------------------------MAR----------------
-----------------------------INSNYLKLP--GSYLFAEMKRKTDAYKAAHP
EADIIRLGIGDVTRPLVPAVIDAMHRAVGEMGSAETFRGYGPEQGYDFLIEAIIANEYAP
LGVE-VAAD-EVFVSDGSKCDVG-NIQE-IFSSDARVAIGDPVYPVYLDSNVMAGRSGGF
GP-SGRFAGITYLTGTEESGFAPAFPR------EPVDLIYLCSPNNPTGTVLPREELARW
VAYAKEHEAVILYDSAYSAYIREA---GVVRSIYEIPGAREVAIEFKSFSKTAGFTGVRC
AFTVVPKELKRRDDRGVPQSVNALWLRRQCTKFNGVSYIVQRGAEAVYT-PGGMRQTREV
IDYYMENAAIIRDGLEAAGYRVFGGKNAPYIWWKLPAG---LDSMSFA-------DKLLN
TCQVVGTPGVGFGPGGEGYFRLTAFGD---RNRTREAVERIRNA---NLG----------
----------------
>gi|150401916|ref|YP_001325682.1|	   416 residues, 50 /line  aminotransferase class I and II [Methanococcus aeolicus Nankai-3]
-----------------------------------------MESY-----IQNLF-----
---------AERIG----------------GKNFGKDD--VIYKFEKIKRAKMEAKAKYP
DIELIDMGVGEPDEMADKEVIETLYNE----AKKHENRGYA-DNGIDELKEAVAKYMKEV
YGVDGIDPKTEVIHSMGSKPALA-YITSVFINPGDVILMTVPGYPVSATHTEWYGGEVYN
------------MPLLEENKFLPDLKSIPDDIKEKAKILYLNYPNNPTGAQATKEFYEEV
VQFAKENNIIVVQDAAYGALTYNG---E-PLSFLSIDGAKDVGVEIHSFSKAYNMTGWRL
AFVV-----------GNDLIVSGF-ATVKDNFDSGQFIPIQKAGIYCL---EHPEITERT
RAKYERRLNKMVNLLNEVGFDAKMPGGTFYLYIKAPKG---TKCGHIFNSGEEFSHYLIK
EKLVSTVPWDDAGHFVRMAACFPAFKD---GEVSEEEEDRILNE---VKRRLSD------
----------VEFIFE
>gi|15669581|ref|NP_248394.1|	   418 residues, 50 /line  aspartate aminotransferase [Methanocaldococcus jannaschii DSM 2661]
-----------------------------------------MESY-----IQNLF-----
---------AERIG----------------GKKFGKED--VIYKFEKIKRAKQEAMKRHP
DMELIDMGVGEPDEMADPEVIRVLCEE----AKKWENRGYA-DNGIQELKDAVPPYMEKV
YGVKDIDPVNEVIHSIGSKPALA-YITSAFINPGDVCLMTVPGYPVTATHTKWYGGEVYN
------------LPLLEENDFLPDLESIPEDIKKRAKILYLNYPNNPTGAQATKKFYKEV
VDFAFENEVIVVQDAAYGALVYDG---K-PLSFLSVKDAKEVGVEIHSFSKAFNMTGWRL
AFLV-----------GNELIIKAF-ATVKDNFDSGQFIPIQKAGIYCL---QHPEITERV
RQKYERRLRKMVKILNEVGFKARMPGGTFYLYVKSPTK---ANGIEF-KTAEDFSQYLIK
EKLISTVPWDDAGHYLRLAACFVAKDENGNPTTEEKYEDMVLEE---FKRRLEG------
----------MDLEFE
>gi|33241846|ref|NP_876787.1|	   421 residues, 50 /line  aspartate aminotransferase [Chlamydophila pneumoniae TW-183]
---------MAIQKAGAFLRCLPSESRP---------YLEHAMR----------------
-----------------------------RNPHFSLLK--PQYLFSEISKKLAQFRKENP
EISVIDLSIGDTTQPLCRSITQAIKEFCVSQEKQETYRGYGPETGLEKLRTKIASEVYEN
---R-ISPE-EIFISDGAKPDIF-RLFS-FFGSEKTLGLQDPVYPAYRDIAHITG-----
------IRDIIPLACRKETGFIPELPNQ-----QSLDILCLCYPNNPTGTVLTFQQLQAL
VNYANQHGTVLIFDAAYSAFVSDP---SLPKSIFEIPEAKYCAIEINSFSKSLGFTGMRL
AWNVIPKELTYD---NNEPMIND-WKRLFATTFNGASLLMQEAG---YY-GLDLFPTPPA
ISLYLTNAQKLKKSLETAGFSVHGGDHAPYLWVELPEG---ISDEEAF-------DFFLH
QYHIAVTPGHGFGSCGQGFVRFSALTQ---PQNIALACDRLCTA---SLK----------
----------ETMVLA
>gi|46446319|ref|YP_007684.1|	   420 residues, 50 /line  aspartate aminotransferase [Candidatus Protochlamydia amoebophila UWE25]
---------MNFLKSG-----------------------SLMVK----------------
-----------------------------RNVHLTKLQ--SGYLFPEINRRKNEFLKKHP
SAQLINLGIGDTTQPIPLYISEAMQNFAKQLASEKTYRGYGTEQGSILLREAIAEQYYQG
---K-IDPQ-EVFVSDGSKCDVG-RLQI-LFGSDATIAVQNPTYPAYVDTGVINGQASFF
QTSTKQYQRITYMSCLPENNFFPDLANL-----PKTDLIYFCSPNNPTGSAATNEQLREL
VQFAKKRQSIIIFDAAYASFVRSS---HIPRSIYEIEGAKEVAIEVGSFSKMIGFTGVRL
GWSVVPKQLRFEDG----HSVQQDWERIVCTFFNGASNIAQAGGLAALQ-KEGLQAIDEL
SSYYMKNSNILKKAFEECGYKVYGGENVPYLWVHFPQ----LTSWEAF-------EILLK
QSQLVSVPGSGFGSAGEGFLRFSAFGK---QSDITVALPRIKHA---LLKIK--------
------------PTVY
>gi|83593746|ref|YP_427498.1|	   413 residues, 50 /line  Aminotransferase, class I and II [Rhodospirillum rubrum ATCC 11170]
------------------------------------------------------------
-----------------------------MDHDFYRIKRLPPYVFAEVNAMKARAR--AA
GDDIIDLGMGNPDQPTPQHIVDKLCEA----ATNPRAHGYSMSRGIPGLRKALAGYYARR
FNVE-LDPETEAIVTLGSKEGLA-NLAQAITSPGDIVLAPNPSYPIHAFGFIIAGGAVRH
---IPAKPGPEFLE-AMERGVRHSVP--------KPVAVLINFPSNPTAYVADLDFYGQV
VDFCRHHGIWILSDIAYSEIYFDH---KPPPSVLQIPGAKEVAIEFTSLSKTYNMPGWRI
GFAA-----------GNRHLIGAL-TRIKSYLDYGAFTPVQVAATAALN-GPQ-DCVEDI
RTLYRERRDVLIDGLAQAGWDIPSPPASMFAWAPLPKGFEHLGSLEFS-------KLLMR
EAKVAVSPGVGFGEYGDSHVRIALVEN---KHRIRQAVRNIKAF---LGGGQGGETG---
-LGAKGEDKQKADEAV
>gi|86357503|ref|YP_469395.1|	   409 residues, 50 /line  succinyldiaminopimelate aminotransferase protein [Rhizobium etli CFN 42]
-----------------------------------------MGN----------------
-----------------------------EMEEFHKVRRLPPYVFEQVNRLKASAR--AG
GADIIDLGMGNPDLPTPQAIVDKLCEV----VQDPRTHRYSSSKGIPGLRRAQAAYYARR
FGVK-LNPDTQVVATLGSKEGFA-NMAQAITAPGDVILCPNPTYPIHAFGFLMAGGVIRS
---MSVEPDETFFP-PLERAVRHSIP--------KPLALILNYPSNPTAFVATLDFYKDV
VAFAKKHDIIVLSDLAYSEIYFDD---TPPPSVLEVPGAMDVTVEFTSMSKTFSMPGWRM
GFAV-----------GNERLIAAL-TRVKSYLDYGAFTPIQVAATHALN-GDG-SDIAEV
RNVYKRRRDVMVESFGKAGFDVPPPAATMFAWAKIPEKFRHLGSLEFS-------KLLVE
KADVAVAPGIGFGEMGDDYVRLALVEN---EHRIRQAARNIKKF---MSTADQTMHN---
-VISLNAH-------R
>gi|94495925|ref|ZP_01302504.1|	   451 residues, 50 /line  aminotransferase, class I and II [Sphingomonas sp. SKA58]
-----------------------------------------MATILFLALRASRLSLACP
YPAGYSPIMTRQRRVTHYSLQDAFRKAPIMSEEFYRMKRLPPYVIAEVNAMRATAR--AA
GEDIIDLGMGNPDLPPPDHVIDKLVEV----ARKPSAHGYSQSRGIPGLRKAQANYYGRR
FGVD-IDPETEVVVTMGSKEGLA-SLATAITEPGDVVLAPNPSYPIHTFGFIIAGATIRS
---VPTTPDENYFR-SLDRAMAFTVP--------RPSILVVNYPSNPTAETVDLAFYERL
VAWAKENKVWILSDLAYSELYYDG---NPTPSILQVPGAKDVAIEFTSLSKTYSMAGWRM
GFAV-----------GNAKLIAAM-TRVKSYLDYGAFTPIQAAACAALN-GPQ-DIVEKN
RLLYHKRRDVLVESFGRAGWDIPAARASMFCWAPLPPALKEMGSLEFS-------KQLLT
HAKVAVAPGVGYGEDGEGYVRIAMVEN---EQRLRQAARNIKAY---LKSMG--------
------INTPSSKGAA
>gi|94986878|ref|YP_594811.1|	   410 residues, 50 /line  Aspartate/tyrosine/aromatic aminotransferase [Lawsonia intracellularis PHE/MN1-00]
-----------------------------------------MAH----------------
-----------------------------TNKHYLDLP--GSYFFTEINQRVNTYKKTHP
EKSIIRLSIGDVTRPLVPAVIKALHDATDEMGQPSSFHGYGPEHGYEFLIGEIIANDYTS
RNVH-IEAD-EIFVSDGTKCDIA-NIQE-LFDPSDTVAIIDPVYPVYIDSNVMSGRLGKL
I--NGIWSKLIYLPCTIENNFIPELPT------QHPDIIYLCYPNNPTGTVLSKDQLTIW
VNYAKKEGAIILFDAAYEAYITDP---TIPHSIYEIDGAKEVAIEFRSFSKTAGFTGLRC
AYTVIPKELKANTREGNEQYLNMMWNRRQTTKYNGCSYIVQKAAAAIYT-PEGQKQIQES
IQYYMKNALIIQNAITQMGITAVGGINAPYVWIKTPDN---LSSWDFF-------DLLLQ
NAGVVGTPGVGFGPHGEGYFRLTGFGS---YEDTNKAIERIQKA---LLI----------
----------------
>gi|109648263|ref|ZP_01372166.1|	   411 residues, 50 /line  aminotransferase, class I and II [Desulfitobacterium hafniense DCB-2]
-----------------------------------------MAQ----------------
-----------------------------INENYLKLP--GSYLFSEIARRVNEFKVQNP
DADIIRLGIGDVTRPLAPVVVEAMKQAVEEMGRAETFRGYGPEQGYDFLIEKIIANDYAP
RGVQ-LGM-DEVFVSDGAKSDTA-NFQE-IFGVDNIMAVTDPVYPVYVDSNVMAGRTGNY
DTEKGQYGRIIYLPCTEEGDMKPELPT------APVDMIYLCFPNNPTGMTLTKEELKVW
VDYARENKAIILFDSAYEAFIREE---GVPRSIYEVEGAREVAVEFRSFSKTAGFTGTRC
AYTVVPKDIMIYDSTGEGHSLNKLWLRRQTTKFNGVSYPVQAGAAAVYT-EEGKKQIQAT
IDYYMENARIIREGLQEAGFKVFGGVNAPYIWMKTPGT---MGSWEFF-------DKLMT
EAHVVGTPGAGFGANGEGFFRLTAFGT---RENTEKAIERIKAR---M-K----------
----------------
>gi|84489723|ref|YP_447955.1|	   411 residues, 50 /line  predicted aspartate/tyrosine/aromatic aminotransferase [Methanosphaera stadtmanae DSM 3091]
----------------------------------------MAVK----------------
-----------------------------VNEYYSLIQ--NNYLFVEIARRVDEYQKENP
DANLIKMGIGDVTRPLAKSVVEAFKRAVDELGDADTFRGYGPEQGYDFLIEDVIENDYKP
LGVE-LKN-SEVFISDGAKCDTG-NFQE-LFSKDNIIAVTDPVYPVYVDSNVMAGRSGKM
G-EDGFYENIVYLPATSENDFVPSLPS------EKVDIIYLCYPNNPTGTTLTKEQLKEW
VDYAHENDALILFDAAYESFIKTP---GIPHSIFEIEGAKDVAVEFRSYSKVAGFTGTRC
AYCVVPEEVYVKDANGNKVQLNPLWNRRQSTKFNGVSYPVQRAAQAIYT-PEGKKEIQEN
LDYYVKNAQVIRESLEKMGLKVYGGVDSPYIWFKTPND---IDSWSFF-------DILLK
EAHVVSTPGAGFGPSGEGYLRLTAFNT---YENTVEAMDRISKL---E-F----------
----------------
>gi|148643515|ref|YP_001274028.1|	   411 residues, 50 /line  aspartate/tyrosine/aromatic aminotransferase [Methanobrevibacter smithii ATCC 35061]
----------------------------------------MVVK----------------
-----------------------------INENYLKLK--SSYLFVEVARREAEFQKNNP
DADIIKMGIGDVTKPLAPSVIKAFQGAVDEMGNADTFRGYGPEQGYDFLAEEIIKNDFEP
FGVS-LDT-DEVFISDGAKCDTG-NIQE-IFDLGNKIAVTDPVYTVYVDTNVMAGRTGEM
K-DDGMYEGLTYLKCNAENGFVPELPE------EDVDIIYLCYPNNPTGTTLTYDQLKVF
VDYAIEHKAIILFDAAYECFIRED---DVPHTIYEIEGAKNVAIEFRSFSKMAGFTGTRC
AYTVVPKEVAGYDSKGNEVQLNQLWNRRQTTKFNGVSYPVQVAAAAVYS-DDGKKEIKEI
IDYYMENAKVIKSSLEKLGLEVYGGVNSPYIWVKTPNN---MDSWAFF-------DLLLN
EANVVGTPGSGFGPSGEGYLRLTAFNT---LENTKEAMDRISKL---N-F----------
----------------
>gi|15678081|ref|NP_275195.1|	   410 residues, 50 /line  aspartate aminotransferase [Methanothermobacter thermautotrophicus str. Delta H]
-----------------------------------------MVT----------------
-----------------------------VNENYLLLK--SSYIFSEINRRVEEFQRKNP
DADIIRMGIGDVTRPLPEAVVEAFHRAVDEMAEEETFRGYGPEQGYPFLREAIAENDYAS
RGVD-ITA-DEIFISDGAKCDTG-NIQE-IFGLDNVVAVTDPVYPVYVESNVMAGRAGPA
D-DDGRYSGLVYLPCTEENSFIPSLPE------ERVDLIYLCYPNNPTGTTLTEKQLAEW
VDYARDSGSLILFDAAYEAYIQED---GIPHSIYEVEGAREVAIEFRSFSKNAGFTGTRC
AFTVVPEELEVPDSSGRMHSVRELWNRRQTTKFNGVSYPVQRAAEAVYT-PEGQREIRES
IDYYMENARIIRESLERAGLRYYGGVNAPYIWIRTPEG---MDSWQFF-------DTLLN
DAEVVGTPGSGFGPSGEGYFRLTAFNS---FRNTVKAMERISEL---S-F----------
----------------
>gi|125975579|ref|YP_001039489.1|	   410 residues, 50 /line  aminotransferase, class I and II [Clostridium thermocellum ATCC 27405]
-----------------------------------------MAF----------------
-----------------------------INENYLKLP--GSYLFSEIARRVDNFRKENP
NAKIIRLGIGDVTKPLAPAVIDALHKAVDEMAKEETFKGYGPEQGYSFLVSKIIEYDYMP
RGIR-LDE-DEVFVSDGAKSDTG-NFQE-IFGLDNKVAVTDPVYPVYVDSNVMAGRTGKY
L-ANGYFENITYLPCTAENNFIPELPK------EKVDIIYLCFPNNPTGMTLSREELKKW
VDYARENRAIILFDSAYEAYIREK---DVPHSIYEVEGADEVAIEFRSFSKTAGFTGTRC
AYTVVPKKVVAYTKNGEAHQLNSLWNRRQTTKFNGVPYIIQRAAAAVYT-PEGQKQTKET
IDYYMENAKIIKQGLEDIGLTVFGGVNAPYIWLKTPDG---ISSWEFF-------DIMLK
EINVVGTPGSGFGPSGEGYFRLTAFGS---RENTLEAVERFKNL---K-F----------
----------------
>gi|78779976|ref|YP_398088.1|	   408 residues, 50 /line  putative aminotransferase [Prochlorococcus marinus str. MIT 9312]
-----------------------------------------MVQ----------------
-----------------------------VNENYLKLK--AGYLFPEIAKRVKIYSQSNK
SAEIIKLGIGDVTEPLPRACIDAMSKALDDMGTAEGFRGYGPEQGYSWLREKISEHDFIS
RGCQ-ILP-EEIFVSDGSKCDSS-NILD-ILGKDNSIAVTDPVYPVYVDSNVMTGRTGDA
L-ENGTYQGLTYLAINEGNNFLPELPQ------KKVDILYLCFPNNPTGATITKEELKKW
VDYALQNKSLILFDAAYEAFIQDN---DIPHSIYEIEGAKDCAIEFRSFSKNAGFTGVRC
AFTVIPKNLKGLSSTNEEIDLWPLWNRRQSTKFNGVSYVVQRGAEAVYS-LEGKKEVRGL
IDFYMENAKIMKNKLQTAGYKVYGGDNAPYIWIKVPDQ---MTSWNFF-------DFLLQ
NVSVVGTPGSGFGLSGEGYFRLSAFNS---RSNVLDAMERIINI----------------
----------------
>gi|149174489|ref|ZP_01853115.1|	   410 residues, 50 /line  aspartate aminotransferase [Planctomyces maris DSM 8797]
-----------------------------------------MAF----------------
-----------------------------INDHYLKLK--AGYLFPEIGRRVNKFCEENP
NAPVIKLGIGDVTEPLPAAIREAMHAAIDEMGDAGSFRGYGPEQGYGFLREAIAKNDFQS
RGVD-ISA-DEIFVSDGSKCDTG-NILD-IFGANNKVAVTDPVYPVYVDTNVMTGRTGAA
D-ESGRYAGLTYLPVTAENNFVAPLPE------SPVDLIYLCYPNNPTGTVATKETLKQW
VDYARANGSIILFDAAYEAFITDP---EIPHSIYEIEGAKEVAIEFRSFSKNAGFTGTRC
AFTVVPKQLKGTTASGEPAEIHPLWNRRHCTKFNGVSYIIQKGAEAVYS-EQGREQIQGL
ISFYLENARLLREGLESVGISVYGGVNAPYVWLKTPGE---STSWEFF-------DELLQ
KAHLVGTPGSGFGASGEGYFRLSAFNT---RDNINEAVTRFQKV---V-S----------
----------------
>gi|33241104|ref|NP_876046.1|	   408 residues, 50 /line  aspartate aminotransferase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
-----------------------------------------MVQ----------------
-----------------------------VNSNYLKLK--AGYLFPEISRRVNAFCELNP
TASLIRLGIGDVTEPLPQACCKAMKTAIEEMGSTSGFRGYGPEQGYLWLREAIAKNDFQS
RGCQ-ISA-DEIFVSDGSKCDSS-NILD-ILGTGNKIAVTDPVYPVYVDSNVMAGQTGIA
A-SSGHYEGLVYIPLNAENGFEAELPS------EPVDLIYLCFPNNPTGAVASKVQLTKW
VEYAKKNHALILFDAAYESFIQDP---LLPHSIFEIDGATDCAIEFRSFSKNAGFTGTRC
AFTVIPKSLKGKTLDGAEVDFWSLWNRRQSTKFNGVSYIVQRGAEAVYS-LEGQSQTNKL
VSFYMKNAEIIRKQLTLAGYKIYGGKHAPYVWLEAPTE---MDSWQFF-------DHLLN
KANIVGTPGSGFGVAGEGYFRLSAFNS---RSNVEEAMRRITSI----------------
----------------
>gi|84519195|ref|ZP_01006544.1|	   408 residues, 50 /line  aspartate aminotransferase [Prochlorococcus marinus str. MIT 9211]
-----------------------------------------MVQ----------------
-----------------------------INGSYLKLK--AGYLFPEISRRVNDFSTANP
KADLIRLGIGDVTEPLPKACCNAMQLAIEEMSTEAGFHGYGPEQGYSWLREAIAKFAYQA
RNCE-ITP-EEIFVSDGSKCDSS-NILD-ILGDNNRIAVTDPVYPVYVDSNVMVGRTGLA
E-KSGRYQGLSYIPMNAENGFEAEIPS------EHFDLIYLCFPNNPTGSVATKEQLMRW
VEYAKNHDALILFDAAYEAFIQDP---ELPHSIYEIDGARDCAIEFRSFSKNAGFTGTRC
AFTVIPKCLRGRSPSNDEVDLWSLWNRRQSTKFNGVSYIVQRGAEAVYS-PEGQSQVSDL
ISFYMDNAQIIRSQLSSIGLQVYGGQNAPYAWIKTPEG---MDSWAFF-------DYLLQ
KANVVGTPGSGFGSSGEGYFRLSAFNS---RNKVNEAMRRITSI----------------
----------------
>gi|88807953|ref|ZP_01123464.1|	   408 residues, 50 /line  aspartate aminotransferase [Synechococcus sp. WH 7805]
-----------------------------------------MVQ----------------
-----------------------------VNGNYLKLK--AGYLFPEIGRRVKAFSAAHP
DAALIRLGIGDVTEPLPQACREAMKTAIDAMGTTEGFHGYGPEQGYGWLREAIATHDFKA
RGCD-ISA-EEIFISDGSKCDSS-NILD-ILGEGNRVAVTDPVYPVYVDSNVMAGRTGEA
G-DEGRYAGLTYLPISADNGFAAQIPT------NPVDLIYLCFPNNPTGAVATKEQLKAW
VDYARANEALILFDAAYEAFIQDP---SLPHSIFEIEGARDCAIEFRSFSKNAGFTGTRC
AFTVVPKGLKGKAANGDAVELWNLWNRRQSTKFNGVSYIIQRGAEAVYS-EAGQAEVKAL
VSFYMENAAIIRRELSAAGLTIYGGEHAPYVWIKTPDG---MDSWGFF-------DHLLH
KANVVGTPGSGFGAAGEGYFRLSAFNS---RDNVDTAMARIQAL----------------
----------------
>gi|72382904|ref|YP_292259.1|	   408 residues, 50 /line  aspartate aminotransferase [Prochlorococcus marinus str. NATL2A]
-----------------------------------------MVK----------------
-----------------------------VNADYLKLK--AGYLFPEISRRITEFSSKNP
NADLIRLGIGDVTEPLPLACREAMKAAIEEMGTKDGFRGYGPEQGYKWLREIISENDYIS
RGCE-ISA-EEIFVSDGSKCDSS-NILD-ILGKENKIAVTDPVYPVYVDTNVMTGRTGEA
N-SVGEYKGLSYIPINSENGFEASIPK------DKFDLIYLCFPNNPTGAVATKEQLVSW
VKYAKENNSLILFDAAYEAFIKDE---SIPHSIFEIEGARDCAIEFRSFSKNAGFTGTRC
AFTVIPKSLKGKA-GIETVDLWSLWNRRQSTKFNGVSYVVQRGAEAVYS-KEGKTQIKKL
VSFYMDNAEIIKSNLTAAGFEVFGAVNAPYAWIKTPKD---MSSWDFF-------DFLLE
KANVVGTPGSGFGAAGEGYFRLSAFNS---RENVEKAMQRIVKL-----K----------
----------------
>gi|113476813|ref|YP_722874.1|	   411 residues, 50 /line  aminotransferase, class I and II [Trichodesmium erythraeum IMS101]
-----------------------------------------MAT----------------
-----------------------------INDNYLKLK--AGYLFPEIARRVNTFAEAHP
EAQIIKLGIGDVTEPLPKACIQAMTKAVAEMGDRSTFKGYGPEQGYAWLREKIAAQDFQG
RGCD-IDA-SEIFISDGSKCDSG-NILD-IIGNNNTIAVTDPVYPVYVDTNVMAGNTGAV
N-EKGEYEGLVYLPIRAENNFTAEIPT------QKVDLIYLCFPNNPTGATATKEYLQTW
VNYARANDAIILFDAAYEAFITDA---SLPHSIYEIEGAKECAIEFRSFSKNAGFTGTRC
ALTVVPKTLKGKAADGSDVELWKLWNRRQSTKFNGVSYIVQRGAEAVYS-EEGKAQVKGL
IQFYLENAKIICSQLQAAGLTVYGGVNAPYVWVQTPTG---LSSWDFF-------DKLLQ
NCNVVGTPGSGFGAAGEGYFRISSFNS---RENVNEAMKRITEK---FKV----------
----------------
>gi|145619102|ref|ZP_01775155.1|	   411 residues, 50 /line  aminotransferase, class I and II [Geobacter bemidjiensis Bem]
-----------------------------------------MAK----------------
-----------------------------INDNYLKLK--AGYLFPEIGRRVRAFAAANP
EAKVIRLGIGDVTQPLTPTILKAFHDAVDDLASENSFMGYGPEQGYDFLIDAIIEKSYKP
LGVD-LKT-TEMFISDGSKCDCA-NILD-IFALDNTVAIGDPVYPVYNDTNVMIGRTGDA
D-DKGYYKGLVYMPCTEENGFFPAYPK------EKVDMIYLCFPNNPTGAVATKAQLKGW
VDYALANDSIILFDAAYEAFITDP---SIPHSIYEVEGAKKCAIEFRSFSKTAGFTGVRC
GLVVVPDELEGTTSNGEKYSFNKLWLRRQTTKFNGASYPVQKAAAAVYT-EQGWKETQAN
IDYYMENARIIREGLSAAGVTVYGGVNAPYIWLKTPAG---LTSWDFF-------DKLLN
DCHVVGTPGSGFGPSGEGYFRLSAFGN---RDNVVEAVERIKKN---LKK----------
----------------
>gi|95928626|ref|ZP_01311373.1|	   411 residues, 50 /line  aminotransferase, class I and II [Desulfuromonas acetoxidans DSM 684]
-----------------------------------------MAR----------------
-----------------------------LNDNYLKLQ--AGYLFPEISRRVTAFADAHP
NDKVIRLGIGDVTKPLVPAVLKAFHDGVDDLAKGASFHGYGPEQGYSWLSQTIIDKAYKP
LGVE-LEA-SEVFISDGSKCDSA-NILD-IFDLSCKVAIGDPVYPVYNDTNVMVGRTGKA
D-EKGYYEGIVYMPCTEENGFAPAFPS------EKVDIIYLCFPNNPTGTVATKEVLKSW
VDYALDNDAVILFDAAYEAFITEP---GIPHSIYEIDGAKKCAIEFRSFSKTAGFTGVRC
GLTVVPHDLMASTADGEKVSLNQLWNRRQCTKFNGVSYPVQKAAAAVYS-DEGWAQVQEI
IAYYMENARIIREGLQEAGITCYGGVNAPYIWLKTPEG---MTSWDFF-------DKLLN
ECFVVGTPGSGFGPSGEGYFRLSAFGE---RENVEEAVKRIRQK---WGK----------
----------------
>gi|94264240|ref|ZP_01288035.1|	   438 residues, 50 /line  Aminotransferase, class I and II [delta proteobacterium MLMS-1]
MTLPAPLFILRGFLSL---------KNIKKILE-----DICMAR----------------
-----------------------------INDNYLKLK--AGYLFPEINRRLKAFSEANP
EARILRLGIGDVTRPLAPAVLEAFRRAVDELGTTATFMGYGPEQGYEWLRQSVIDHAYTP
RGVK-LAP-SEIFISDGSKCDCA-NILD-IFDLGNKVAIGDPVYPVYNDTNVMVGRTGEA
D-AHGHYQGIVYIPFTAENNFSPEPPA------EKVDLIYLCFPNNPTGAVASKAELKKW
VDYARQNEAVILFDAAYEAFITDP---QIPHSIYEIEGAEQCAIEFRSFSKTAGFTGVRC
ALTVVPQALTGRDAAGEPVALNPLWNRRQSTKFNGVSYPVQRAAEAVYS-PEGWRQNQEI
IDFYLENAHLIRQGLEASGVKCFGGTNAPYIWLQTPAG---MSSWDFF-------DKLLN
NCHVVGTPGSGFGPGGEGYFRLSAFGQ---RETVEEAVARIRRQ---LSS----------
----------------
>gi|150271492|gb|EDM98749.1|	   407 residues, 50 /line  hypothetical protein BACCAP_03551 [Bacteroides capillosus ATCC 29799]
---------------------------------------MHMTT----------------
-----------------------------INRNYLKLP--GSYLFSEIARRVSVYADANP
DKKLIRLGIGDVTRPLVPAVTAAMHAAVDEMATAEGFHGYGPEQGYDFLREAIAAHDYHA
RGVE-IDP-SEIFVSDGAKSDCG-NIGD-IFGTDNVVAVCDPVYPVYVDTNAMAGRAGDF
SEETGKWNRLVYMPCVAENGFAPAIPE------EKADLVYLCFPNNPTGAVATRAQLQAW
VDWANANGSVILFDSAYEAFISDP---EIPHTIFEIPGAKTCAIEFRSFSKTAGFTGTRC
AYTVVPKALE---RDG--ASLNALWNRRQCTKFNGVPYVVQRGAAAIYT-PEGHAQVMEN
IAFYKRNAKVIFDGLKAAGLTVSGGENSPYVWAKTPDG---MGSWEFF-------DKLLH
QANVVTTPGAGFGPSGEGYIRLTAFGG---ADATVEAVERICKV---L------------
----------------
>gi|86608889|ref|YP_477651.1|	   416 residues, 50 /line  aminotransferase, classes I and II [Synechococcus sp. JA-2-3B'a(2-13)]
-----------------------------------------MAR----------------
-----------------------------INDHFLKLK--TGYLFPEIARRVQAFATAHP
EAQIIKMGIGDVTEPLPEACRTAMIRAVEEMGERATFRGYGPEQGYEWLRQAIARHDFQA
RNCD-IDA-SEIFVSDGSKCDCG-NILD-ILGHDNTIAITDPVYPVYVDTNVMAGHTGPA
N-ERGEYEGLVYLPITAENHFTASLPS------QKVDVIYLCFPNNPTGAVATREHLQNW
VDYARAHGSLILFDAAYEAYITEP---GIPHSIYEIPGARECAIEFRSFSKTAGFTGTRC
AFTVVPKSLRGQAADGSWVDLWSLWYRRQSTKFNGVSYIVQRGAEAVYS-EAGQAQVQGL
VQFYLENARIIRQQLAEVGIQVYGGVNAPYVWVKTPDG---LSSWEFF-------DKLLH
TCHVVGTPGSGFGSAGEGYLRLSAFNS---RANVEEAMRRIGSV---FAGAG--------
-------------AVG

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.