Fandom

Proteins Wiki

At2g13720.1/MSA

< At2g13720.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|15225481|ref|NP_178993.1|	   223 residues, 50 /line  ATP binding / DNA binding / DNA topoisomerase (ATP-hydrolyzing) [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------MWAL
V-----------------------------------------AQAERLG--SMRCRA---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------SRMPRGREWPRVRVPRDGLKS-SFITVLVT
PYVKVSRL------TFSSHKYFIVLTNLSYVTSTLNTRNGKMKDRN--YLNRWTIKFYKG
VWVQVMRE-KNVLSNVDQNKRFFIW-DEGSEAALENAFGTSE-DKQKKWIEKYVPGT---
---------FL-DSKKQQIMYSDFVTKKLKLYFTTSNQRKHININKKNYILKKNDKKSKK
IILKKYEKKVIQYIIIVLLI----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|10281012|dbj|BAB13747.1|	   777 residues, 50 /line  type II DNA topoisomerase [Kluyveromyces marxianus]
---------------------------------------------------------TDC
MI---------------------------EKTVNIVPGLFKIFDEILVNAADNKVRD--P
SMKKIDVTINQEENLIEVRNDGKGIPVEIHEKEG---IYIPEMIFGHLLTSSNYDDDEKK
VTGGRNGYGAKVCNIFSTEFILETADPSKGQKYVQKWENNMSVCHPPSITSYKRGPSYTK
VSFRADLQRFNMEKLDDDIVGVMRRRVYDINGSVRDVNVSLNGKPLKIKNFKNYVELYLK
SLEKIK-----------------LNRLQELTNPDEPAQE---PTNIPAILYEKINDRWEI
AFAVSENS-FQQISFVNSIATTSGGTHVNYVTDQIVKKVSDRLKKQKKS-----IKPFQI
KNNMF--IFINCLIENPAFTSQTKEQLTTRVKDFGSK--CE--VP-NDFVNK-VMKTDLA
TRIFDIADENAEKQLKKT----DGSRK-NRITEYPKLEDANKAGTKEGYKCTLVLTEGDS
ALSLAVAGLAVVGRDYYGCFPLRGKMLNVRDATPDQITKNAEIQAIKKIMGLQHKKR-Y-
--EDATSLRYGHITIMTDQDHDGS-HIKGLIINFLESSFPGL------LDIPGFLIEFIT
PIIKITIT---RPKKQ-TISFYNMPDYE------------KWREEESHK-YTWKQKYYKG
LGTSTQQEAREYFSQLDLHLKKFHALQGDDCQLIDLAFSKKKADDRKEWLKLYEPGT---
---------VL-DPKLTEIPISDFINKELILFSLADNIRSIPSV------LDGLKPGQRK
VIYACFKRNLKSEIKVAQLGGYVSEHTGYHHGEPSLYQTIVGLAQDFVGSNNIYLLKPNG
AFGTRATGGKDSAAPRYIFTELNKITRKIFNSLDDPLLTYIQDDEQTVEPEW--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|1633273|pdb|1BGW|	   793 residues, 50 /line  Topoisomerase Residues 410 - 1202,
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------ENALKKS----DGTRK-SRITNYPKLEDANKAGTKEGYKCTLVLTEGDS
ALSLAVAGLAVVGRDYYGCYPLRGKMLNVREASADQILKNAEIQAIKKIMGLQHRKK-Y-
--EDTKSLRYGHLMIMTDQDHDGS-HIKGLIINFLESSFLGL------LDIQGFLLEFIT
PIIKVSIT---KPTKN-TIAFYNMPDYE------------KWREEESHK-FTWKQKYYKG
LGTSLAQEVREYFSNLDRHLKIFHSLQGNDKDYIDLAFSKKKADDRKEWLRQYEPGT---
---------VL-DPTLKEIPISDFINKELILFSLADNIRSIPNV------LDGFKPGQRK
VLYGCFKKNLKSELKVAQLAPYVSECTAYHHGEQSLAQTIIGLAQNFVGSNNIYLLLPNG
AFGTRATGGKDAAAARYIYTELNKLTRKIFHPADDPLYKYIQEDEKTVEPEWYLPILPMI
LVNGAEGIGTGWSTYIPPFNPLEIIKNIRHLMNDEELEQMHPWFRGWTGTIEEIEPLRYR
MYGRIEQIGDNVLEITELPARTWTSTIKEYLLLGLSGNDKIKPWIKDMEEQHDDNIKFII
TLSPEEMAKTRKIGFYERFKLISPISLMNMVAFDPHGKIKKYNSVNEILSEFYYVRLEYY
QKRKDHMSERLQWEVEKYSFQVKFIKMIIEKELTVTNKPRNAIIQELENLGFPR-FNKEG
KPYYGSPNDEIAEQINDVKG---ATSDEEDEESSHEDTENVINGPEELYGTYEYLLGMRI
WSLTKERYQKLLKQKQEKETELENLLKLSAKDIWNTDLKAF-------------------
------------------------------------------------------------
-----------------------EVGYQEFLQRDAEARGGNVPNKGSKTKGKGKRKLVDD
ED---------------------
>gi|10281014|dbj|BAB13748.1|	   804 residues, 50 /line  type II DNA topoisomerase [Issatchenkia orientalis]
---------------------------------------------------------LKC
ME---------------------------KKTVSIVPGLFKIFDEILVNAADNKIRD--P
SMKRIDVIINEEENVISVKNDGKGIPIEIHDKEN---IYIPELIFGNLLTSSNYDDDQKK
VTGGRNGYGAKLCNIFSTEFTVHTADMSHGKEYTQVWRNNMSEVGKPKILNFKKKNEFTE
IIFKPDLSKFGMEKLDHDILGVFKRRVYDLCGSVRGIRVTLNGELLKINNFKQYVELYVK
AINKSKEERPHIPVKIETEDGTPLNGESEANTETSSTPEPSLNENLPTIVHEIINDRWEI
AFCISDGS-FNQVSFVNSIATTLGGTHVDDVANMLCGKITEQIKRKNK---KAIIKPFQI
KSKMF--LFINCLVENPAFTFQTKEYLTTQLSKFGGK---RLELP-EKFIKK-ILNTGII
DEVLDIVQANADKALKKT----DGAKK-SRITGYPKLEDANKAGTREGYKCTLILTEGDS
AKSLAVQGLAVVGRNYYGCFPLRGKVLNVREASTDQIMKNGAIQAIKQIMGLQHKKH-Y-
GPDDIKSLRYGRIMIMADQDHDGS-HIKGLLINFLEASFPGL------LEIPNFLIEFIT
PIVKITIMS-GPNRRK-TIPFYSMPEYE------------QWRETEGST-CSYKQKYYKG
LGTSSAQEMREYFTQLDKHLKRFDALRDEDKSSIDLAFSKKKADDRKEWLRNYQPGT---
---------YL-DSTLSDIPISEFINKELILFSMADNVRSIASV------MDGFKPVQRK
ILYACYKRNLRDEIKVSQLEGYIAEHTGYHHGDASLMQSIIGLAQDFVGSNNINLLVPHG
GFGSRAAGGKDAAAARYIFTELSAITRKIFNPLDNPLLTYVQDDEQTVEPEW--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|10281026|dbj|BAB13754.1|	   782 residues, 50 /line  type II DNA topoisomerase [Pichia guilliermondii]
---------------------------------------------------------TES
MI---------------------------YKEVHIVPGLYKIFDEILVNAADNKIRD--P
SMRNIKVNIDAENNTILVMNDGKGIPIEIHKKEK---IYIPELIFGNLLTSSNYDDDEKK
VTGGRNGYGAKLCNIFSTEFVLETADLNTSQVYKQTWTNNMANLTKPKITKLKSKKEYTK
VTFKPDLSKFHMEMLDDDILSVLRRRVYDLCGTVKDCNIYLNDKKLSIRNFKSYVEMYVN
AIRE---RSPD-PVAPEGE-----------------------TRNYSTIVHEVFNDRWEV
AFAVSDGS-FNQVSFVNSIATTSGGTHVKYVSDQIITKLIDALTKKEKGKKKLNIKPQEV
RNNMF--VFINCLIENPAFTSQTKEQLTTRVAQFGGKPLEKIVIS-DQFIAK-ILKTSIA
DKIRTIVNANEDKEMLKA----DGSRK-SRIKNQVKLVDANKAGTKEGYKCTLILTEGDS
AMPLAVAGLTVVGRDYYGCFPLRGKLLNVREASIEQVSKNAEINSIKQIMGLQHKKR-Y-
TPENIKSLRYGHIMIMTDQDQDGS-HIKGLIINFLETSFPGL------LEIPGFLLEFIT
PIVKVTIT--GRGNHR-VIPFYNMPEFE------------KWRETEGTT-CKWKHKYFKG
LGTSLESEGREYFAALDRHMKSFHALQDGDSQYIDMAFSKKKADERKDWLQAFRPGT---
---------HL-DPQIREIPISEFINKELILFSMADNVRSIPSI------LDGFKPGQRK
VLYGCFKRNLRSEIKVAQLVGYISEHTGYHHGEGSLAQTIVGLAQNFVGANNLNLLQPIG
LFGSRAAGGKDFSAVRYIHTNITDLTRVIFNPLDDDLYTYVQDDAQTVEPEA--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|10281028|dbj|BAB13755.1|	   772 residues, 50 /line  type II DNA topoisomerase [Clavispora lusitaniae]
---------------------------------------------------------SEK
MV---------------------------QKSVKIVPGLYKIFDEILVNAADNKIRD--P
SMKQLKVNIDVESNTITVRNDGRGIPVEIHEKEQ---MYIPEMIFGNLLTSSNYDDDEKK
VTGGRNGYGAKLCNIFSTEFTVETADLSNGKVYQQVWTNNMSKCNPPKIKKMTAKREYTQ
ITFKPDLAKFGMERLDDDIVSVMKRRVFDLCGTVRDCSVFLNDTKLPIKSFKQYVDMYVQ
ALRQ---LDDS-D-----------------------------DPKSSVVVHENFGDRWEV
AFAVSDGS-FQQVSFVNSIATTSGGTHVKMLTDSIVKQLTESISAKRGKKKALMVKPQEV
KNNMF--LFVNCLVENPAFTSQTKEQMTTKPAKFGSK---PV-IT-EDFIKKLIAKTSIT
DKLHSLSQANEDKALARQ----DGSRR-SRVKS-AKLHDANKAGTKDGHKCTLILTEGDS
ALAQAVVGLKVVGNEYYGCFPLRGKMLNVRDASADQISKNAEINEIKKIIGLQHKKH-Y-
TPESLKSLRYGHILIMTDQDHDGS-HIKGLLINFFESSFPGL------LQCPGFLQGFIT
PIVKVTILG---RHKK-VIPFYNMPDFE------------RWRESEEAQANRWTHKYYKG
LGTSLATEITEYFQQLSRHLKRFHALQDDDKQYIDLAFNKKKADDRKDWLGAYIPGT---
---------QL-DPEIEEIPIADFINKELILFSMADNIRSLPCV------LDGLKPAQRK
VIYGLQKRAGNREGKVNDLAGYISSNTAYHHGDQSLVMTIVSMAQDFVGANNINLLEPRG
NFGSRFMGGKDASAARYIHTCLSEITKSVYNPLDNSLYKYVQEDESTVEPQW--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|10281016|dbj|BAB13749.1|	   782 residues, 50 /line  type II DNA topoisomerase [Candida tropicalis]
---------------------------------------------------------TES
MV---------------------------FKEVTIVPGLYKIFDEILVNAADNKIRD--P
TMKNIKVKIDPENNTIEVMNDGKGIPVEMHTKEN---MYIPELIFGNLLTSSNYDDNQKK
VTGGRNGFGAKLCNIFSTQFEVETADLNTGKLYKQVWTDNMTNVAKPKITTLRTKKEYTK
ITFKPDLAKFDMDSLDEDLLAVLRRRVYDLCGTVKNCNIYLNDKRLSISSFKSYVEMYVK
AIRE---RSPE-PLT---EDGTS--------------------KNFTTIVHEVFNERWEV
AFAVSDGT-FNQVSFVNSIATTAGGTHVKYVSDQIINKLVETLSKKEKGKKKLMIKPQEV
RDNMF--LFINCLIENPAFTSQTKEQLTTKVSQFGGK--QKFVAN-DNLINR-ILKTSIV
DKIRAIANANEDKALQKA----DGSRK-SRIKGQVSLVDANKAGTKLGHNCTLILTEGLS
ALNLAVAGLSVVGRDYYGCFPLRGKLLNVREASADQISKNAEINALKQIIGLQHKKH-Y-
TAENIKQLRYGHIMIMTDQDQDGS-HIKGLIINFLETSFPGL------LEIPGFLLEFIT
PIVKVTIKTRGSGNNR-VIPFYTMPEFE------------AWRDGEGSQ-CRWTHKYYKG
LGTSTPMEAREYFTALDRHLKKFHALQGEDASYIDLAFSKKKADERKDWLQGFIPGT---
---------HL-DPEINEIPISDFINKELILFSMSDNIRSIPSV------LDGLKPGQRK
VLYGCIKKKLKSEIKVAQLAGYVSENTGYHHGEQSLVQTIIGLAQNFVGSNNINILKPNG
SFGSRAAGGKDFSAARYIFTELNEITRKIFNPLDDPLYNYVQDDEQTVEPEW--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|10281020|dbj|BAB13751.1|	   782 residues, 50 /line  type II DNA topoisomerase [Candida dubliniensis]
---------------------------------------------------------TES
MV---------------------------FKEVTIVPGLYKIFDEILVNAADNKIRD--P
SMKNIRVKIDAENNIIEVMNDGKGIPVEMHTKEN---MYIPELIFGNLLTSSNYDDNEKK
VTGGRNGFGAKLCNIFSTQFEVETADLNMGKLYKQSWTNNMSNVSKPKITTLKTKKEYTK
ITFRPDLSKFDMDCLDNDLLSVLRRRVYDLCGTVKNCNIYLNEKRLNISSFKSYVEMYVK
AIKE---RSPE-PEP---QDGTI--------------------KNFTTIVHEVFNDRWEV
AFAVSDGS-FNQVSFVNSIATTSGGTHVKYVSDQIINKLVETLSKKEKGKKKLMIKPQEV
RDNMF--LFINCLIENPAFTSQTKEQLTTKVSQFGGK--DKFVAN-DNLINR-ILKTSIV
EKIRAIANANEDKALQKA----DGSRK-SRIKGQVNLVDANRAGTKDGHNCTLILTEGLS
AMNLAVAGLSVVGRDYYGCFPLRGKLLNVREASADQIAKNAEINSLKQIIGLQHKKV-Y-
TAENIKSLRYGHIMIMTDQDQDGS-HIKGLIINFLETSFPGL------LDIPGFLLEFIT
PIVKVTVRARGAGGKR-VIPFYTMPEFE------------HWRDTEGKQ-CRWTQKYYKG
LGTSTPMEAREYFTALDRHLKRFHALQGEDKNYIDLAFSKKKADERKEWLQGFLPGT---
---------HL-DPEITEIPISDFINKELILFSMSDNVRSIPSV------LDGFKPGQRK
VLYGCFKKKLRSEIKVAQLAGYVSENTGYHHGEQSLVPTIIGLAQNFIGSNNINVLKPNG
SFGSRAAGGKDFSAARYIFTELSEITRKIFNPLDDPLYTYVQDDEQTVEPEW--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|10281022|dbj|BAB13752.1|	   779 residues, 50 /line  type II DNA topoisomerase [Candida parapsilosis]
---------------------------------------------------------SES
MK---------------------------FQEVTIVPGLYKIFDEILVNAADNKIRD--P
SMKNIKVRIDPENNVIQVFNDGKGIPVEMHTKEK---MYIPELIFGNLLTSSNYDDDQKK
VTGGRNGFGAKLCNIFSTQFEVETADLNTGKLYKQTWTDNMTKVGKPKITALKTKKEYTK
ITFKPDLSKFDMDSLDEDLLSVLRRRVYDLCGTVRNCNIYLNDKRLSVNSFKSYVEMYVK
AIKE---RSPE-PEG---E-GAP--------------------KNFTTIVHEVFNDRWEV
AFAVSDGT-FNQVSFVNSIATTAGGTHVKYVSDQIISKLVETLSKKEKGKKKLMIKPNEV
RDNMF--IFINCLIENPAFTSQTKEQLTTKVSQFGGK--EKFVAS-DNLIAR-VLKTGIA
EKIRDIANANEDKALQKV----DGSRK-SRIKGQVNLVDANKAGTKDGTKCTLILTEGLS
ALNLAVAGLTVIGRDYYGCFPLRGKLLNVREASADQIAKNAEINALKQIIGLQHKKA-Y-
TAENIKSLRYGHIMIMTDQDQDGS-HIKGLIINFLETSFPGL------LDIPGFLLEFIT
PIVKVTVKGR--GAKK-VIPFYSMPEFE------------AWREGEGQT-CRWTQKYYKG
LGTSTPMEAREYFTALDRHLKRFHALQGEDSNYIDLAFSKKKADERKEWLQNFVPGN---
---------QL-DPELNEIPISEFINKELILFSMSDNIRSIPSV------LDGLKPGQRK
VLFGCFKRNLKSEIKVAQLAAYVSENTGYHHGEVSLVQTIIGLAQNFVGSNNINILKPNG
AFGSRATGGKDAAAARYIFTELNDITKAIFNPLDNPIYSYVQDDEQTVEPQW--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|10281024|dbj|BAB13753.1|	   779 residues, 50 /line  type II DNA topoisomerase [Candida parapsilosis]
---------------------------------------------------------SES
MK---------------------------FQEVTIVPGLYKIFDEILVNAADNKIRD--P
SMKNIKVRIDPENNVIQVFNDGKGIPVEMHTKEK---MYIPELIFGNLLTSSNYDDDQKK
VTGGRNGFGAKLCNIFSTQFEVETADLNTGKLYKQTWTDNMTKVGKPKINALKTKKEYTK
ITFKPDLSKFDMDSLDEDLLSVLRRRVYDLCGTVKNCNIYLNDKRLPVTSFKSYVEMYVK
AIKE---RSPE-PEG---E-GAP--------------------KNYTTIVHEVFNERWEV
AFAVSDGS-FNQVSFVNSIATTAGGTHVKYVSDQIITKLVETLSKKEKGKKKLMIKPNEV
RDNMF--IFINCLIENPAFTSQTKEQLTTKVSQFGGK--EKFVAS-DNLISR-VLKTGIA
DKIRDIANANEDKALQKV----DGSRK-SRIKGQVNLVDANKAGTRDGLKCTLILTEGLS
ALNLAVAGLTVIGRDYYGCFPLRGKLLNVREASADQIAKNAEINSLKQIIGLQHKKT-Y-
NAENIKSLRYGHIPIMTDQDQDGS-HIKGLIINFLETSFPGL------LDIPGFLLEFIT
PIVKVTVKGR--GAKK-IIPFYSMPEFE------------TWRDGEGQT-CRWTQKYYKG
LGTSTPMEAREYFTALDRHLKRFHALQGEDSSCIDLAFSKKKADERKEWLQNFVPGN---
---------QL-DPALNEIPISEFINKELILFSMSDNIRSIPSV------LDGLKPGQRK
VLFGCFKRNLKSEIKVAQLAAYVSENTGYHHGEVSLVQTIIGLAQNFVGSNNINILKPNG
AFGSRATGGKDAAAARYIFTELNDITKAIFNPLDNPIYTYVQDDEQTVEPQW--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|10281018|dbj|BAB13750.1|	   782 residues, 50 /line  type II DNA topoisomerase [Candida tropicalis]
---------------------------------------------------------TES
MV---------------------------FKEVTIVPGLYKIFDEILVNAADNKIRD--P
SMKNIKVKIDPENNIIEVMNDGKGIPVEMHTKEN---MYIPELIFGNLLTSSNYDDNQKK
VTGGRNGFGAKWCNIFSTQFEVETADLNTGKLYKQTWTDNMTNVSKPKITTLKSKKEYTK
ITFKPDLSKFDMDSLDDDLLAVLRRRVYDLCGTVKSCNIYLNDKRLSISSFKSYVEMYVK
AIRE---RSPE-PLA---EDGTL--------------------KNFTTIVHEVFNERWEV
AFAVGHST-FNQVSFVNSIATTAGGTHVKYVSDQIINKLVDTLSKKEKGKKKLMIKPQEV
RDNMF--LFINCLIENPAFTSQTKEQLTTKVSQFGGK--EKFVAG-DNLISR-ILKTSIV
DKIRAIASANEDKALQKV----DGSRK-SRIKGQVSLVDANKAGTKLGHNCTLILTEGLS
ALNLAVAGLSVVGRDYYGCFPLRGKLLNVREASTDQISKNAEINALKQIIGLQHKKH-Y-
TAENIKQLRYGHIMIMTDQDQDGS-HIKGLIINFLETSFPGL------LEIPGFLLEFIT
PIVKVTVKTRGSGNNR-VIPFYTMPEFE------------AWRDGEGAE-CRWTHKYYKG
LGTSTPMEAREYFTALDRHLKKFHALQGQDSNYIDLAFSKKKADERKEWLQGFIPGT---
---------HL-DPEINEIPISDFINKELILFSMSDNIRSIPSV------LDGLKPGQRK
VLYGCIKKKLKSEIKVAQLAGYVSENTGYHHGEQSLVQTIIGLAQNFVGSNNINILKPNG
SFGSRAAGGKDFSAARYIFTELNEITRKIFNPLDDPLYNYVQDDEQTVEPEW--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|115534553|ref|NP_503483.2|	   616 residues, 50 /line  Y46H3C.4 [Caenorhabditis elegans]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------MDRHRIRFK-YNG--ADAIDMVFSKKKSEERKDWLSKWMREKKDR
KQQGLAEEYLY-DKDTRFVTFKDFVNRELVLFSNLDNERSIPCL------VDGFKPGQRK
VLFACFKRSDKHGVKVAQLAGGVADMSAYHHGEQSLMTTIVHLAQDY-------------
-------GGKDSASAQYIFTQLSPVTRTLFPSHDDNVLRFLYEENQRIEPEWYCPISPMV
LVNGAQGIDTGWRTNIPNYNPRELVKNIKRLIAGEPQKALAPWYKNFRGKIIQIDPRRFA
CYGEV-------------------------------------------------------
-------------------ALQSVICMSSMVLFDAAGCLRTSTSPEAITQEFYDSRQEKY
LQRKEYLLEVLQAQSKRLTNQARFILAKINKEIVFENKKKVAIVDDLIKMGFDADPVKKW
KEEQKLKLRESGEMDED-DLATVAVEDDEGVSSAAKAVETKLSG-------YEYLFGMTI
LDVSEEETNKLINESEEKMTELRVLKKKTWQDLWHEDLDNFLSELDKQEARERGDQDAML
ENAVKKLAADAKSGRGSTKNVCPEVLPSKDGHRIEPRFDAATKAKYEKMTQPKRERVKKE
PKKLAWQADCDDDVGVTSDEEVIRKPKPRAERRAAKKPAVEAPAKKAEPKKKKNNKLYDM
SGGESADDVGEKEGSDNGSVGSG
>gi|32813238|emb|CAE11801.1|	   345 residues, 50 /line  topoisomerase II [Leishmania panamensis]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------TEGDS
AKTLCTAGLAVKDRDYFGVFPLRGKPLNVREASLKKLAACEEIQCVMKIMGLDIRQK-Y-
--ENTDGLRYGHLMIMSDQDHDGS-HIKGLLINFIHCFWPNL------LRVPGFLQQFIT
PIVKARPKGRG-GAGK-AISFFSMPDYF------------EWKKAIGDNLSNYQIRYYKG
LGTSGAEEGREYFENIDRHRLSFVEQDQSEEDRIVMAFGKDRVEDRKEWITNFKTNVNVN
E--------SM-DYSVRQVSYRDFVDKELILFSIADCERSIPSA------IDGFKPGQRK
ILFSCFKRNLVNSIKVVQLAGYVSEHSAYHHGEQSLVQTIVGMAQDFVGSNNVPLLRKDG
QFGTRLHGGKDHAAPRYIFT----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|34419280|ref|NP_899293.1|	   597 residues, 50 /line  topoisomerase II large subunit [Vibrio phage KVP40]
---------------------------------------------MSKQDNFQILSDKQH
VLKRPGMYIGSVDREAHERFVLGE-----YKQIEYVPGLVKIINEVIDNSLDEAIRT--K
FKFANVIEVKVEGNRITIADNGRGIPQDKVIDPHGNELLRPEAAWTRTKAGSNFEDD--R
TTVGMNGVGAALTNYFSHQFIGKTCD---GKNTVTVSCSN--NAERIFVRTSKGGTQGTS
VEFIPDFNRFGVFGISPQDEEIIKDRLAALSVAFPEITFKYNGKK-HAPTLKQYAKMFG-
-----------------------------------------------TD-VSF-EFDNVA
LFIAASD-EFRHNSFINGVHTINGGTHVDYFSNKLADELIPMIKRKHK----INVPKPQL
KNGLTIGLFIRNFVD-PKFDSQTKERLTSSQGDVSPY--LK-DISYDKIAKK-ILADDDI
IMPIIEALLAKQHAAEAR--ELARKQKK---AQNAKVVDHIKATMPGG---TLFLTEGKS
AIGYLI---KVRDSKKHGGIPLRGKVLSTWGKRPAKIMENKELCDIMSVLNIQL---GN-
--DDIRDMYYHDIGILVDADVDGKGSIFPLLLAFF-YNWPEL------YK-QKRIKFVRT
PVVIATNK------KE-TKWFYSIDEYR------------KAKLS-----KTWKIRYIKG
LGSLTEKEYKKVINEPV-----FDEIVIDDPSCFELLFGDD-TDKRKDWMTQ--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|37651488|ref|NP_932362.1|	   607 residues, 50 /line  topoisomerase II large subunit; gp60plus39 [Bacteriophage 44RR2.8t]
-----------------------------------------------MSDEFKVLTPREH
VILRPNMYVGSVAYEPHERFLFGK-----FQSVSYVPGLVKIIDEIIDNSVDEGIRTDFK
FANKIDIRFDLLEGSVTVVDNGRGIPQSMVETPDG-EMPKPVAAWTQTMAGSNFDDTN-R
VSMGMNGVGSSLTNFFSKKFIGETCD---GKNFLTVTCSE--GASNIDWETKPGKIKGTS
VYFIPDEKHFEGRTIDQQIIDIISDRITALSVVFPQIKFTINGQIASMK-FADYAKMFG-
-----------------------------------------------DESLIV-ESDRFS
IAICNSPEGFRQVSYVNGLNIKNGGSHIDYLVDGISEELMPAIKKKHK----IEISKARV
KECLTM-VVVVRGMSNLRFDSQTKERLTNPAGEVKSH--F--DLDFKKLSKQ-IMNTDAI
LQPIIEAALARHLAAEKA--AMTKAQKAAAKTNCAKHIKAGEWG-RNDIETTLFLTEGES
AIGYL---LKVKDENLHGGYALRGKVMNTWGMKGSDVLKNNELSDICAITGLDLA--NP-
--DDISQRKYKNIAIMTDADPDGQGSIYPCLLAFF-ARWPKL------FD-EGSVRFVKT
PVVILNKG------KN-TKWFYTLTEFE--------------KEKK--DYKGWDLRYIKG
LGSLREHEYSDVVNNPNYDIVDL----GDDWEELFEMLLGDDAALRKEWMSQ--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|68062299|ref|XP_673155.1|	   426 residues, 50 /line  hypothetical protein PB300551.00.0 [Plasmodium berghei strain ANKA]
------------------------------------------------------------
---------------------NSN-----FNNNK--------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------YEEEI--
-----------------------------------------------VKIHEK-QHRWEI
VISKTDGSQFQQVSFVNSICTTKGGTHVSYIVDQLLNSLSKKANAKNKG--GMEIKSGHI
RNHLW--VFVNCLIVNPTFDSQTKETLTTKQSKFGSK--C--ILT-DKTINN-VLKSSIL
SNILLWAQAKAQVELRKKMKAGSSKAR-ERIIGIPKLEDANDAGSKYSQECTLILTEGDS
AKTSCLAGLSIVGRDRYGVFPLKGKLLNVRDASFKQLMDNKEIQNIFKIMGLDITDKNK-
--QDIKGLRYGSLMIMTDQDYDGS-HIKGLLINMIHKFWPSL------LKHKGFLCEFVT
PIVKVQKG------NQ-ELSFFTIAEYE------------QWKENT--NLVGWKIKYYKG
LGTSTDKEFKQYFSDIQSHKIVFLWTGDRDGDSIDMAFSKKRIEDRKLWLQNFILGS---
---------YV-DHKEKDLSYYDFVNKELIYYSRYD------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|111305596|gb|AAI21351.1|	   757 residues, 50 /line  LOC779457 protein [Xenopus tropicalis]
MSKSGGGGGAGGGSGGLTWVTLFDNQNASKKEETESNNKNDSSKKMSVERVYQKKTQLEH
ILLRPDTYIGSVETVTQSMWVYDEDVGMNCRDITYVPGLYKIFDEILVNAADNKQRD--K
NMNCIKISIDPDSNIISIWNNGKGIPVVEHKVEK---MYVPALIFGQLLTSSNYDDEEKK
VTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWTNNMLKTTEPKIKHFD-GDDYTC
ITFQPDLAKFQMEKLDKDTVALLTRRAYDIAGSCKGVKVLLNGKKLPVNGFRSYVDLYVK
DRLD--------------ETGVA-----------------------LKVIHEVANERWDV
CLTLSEKG-FQQISFVNSIATTKGGRHVDYVVDQIVSKLIEVVKKKNK--AGVSVKPFQV
KNHVW--VFVNCLIENPTFDSQTKENMTLQPKGFGSK--CQL--S-EKFSKA-ASNCGIV
ESILNWVKFKAQTQLNKKC---SSVKH-SKIKGIPKLDDANDAGGKHSLDCTLILTEGDS
AKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKS-YD
DNESLKTLRYGKIMIMTDQDQDGS-HIKGLLINFFHHNWPSL------LK-HSFLEEFIT
PIVKATK------NKQ-ELSFYSIPEFE------------EWKKQTENQ-KLWKIKYYKG
LGTSTSKEAKEYFADMDRHRIIFRYAGPEDDAAITLAFSKKKVDDRKEWLTNFMEDRRQR
RLHGLPEQ-FLYGTATKHLTYNDFINKELILFSNSDNERSIPSL------VDGLKPGQRK
VLFTCFKKKKK-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|149040009|gb|EDL94093.1|	   733 residues, 50 /line  similar to topoisomerase (DNA) II beta [Rattus norvegicus]
MAKS----SLAGVDGALTWVN-----NAAKKEELETANKNDSSKKLSVERVYQKKTQLEH
ILLRPDTYIGSVEPLTQLMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRD--K
NMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEK---VYVPALIFGQLLTSSNYDDDEKK
VTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFD-GEDYTC
ITFQPDLAKFKMEKLDKDIVALMTRRAYDLAGSCKGVKVMFNGKKLPVNGFRSYVDLYVK
DKLD--------------ETGVA-----------------------LKVIHELANERWDV
CLTLSEKG-FQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNK--AGVSVKPFQV
KNHIW--VFINCLIENPTFDSQTKENMTLQPKSFGSK--CQL--S-EKFFKA-ASNCGIV
ESILNWVKFKAQTQLNKKC---SSVKY-SKIKGIPKLDDANDAGGKHSLECTLILTEGDS
AKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKS-YD
DAESLKTLRYGKIMIMTDQDQDGS-HIKGLLINFIHHNWPSL------LK-HGFLEEFIT
PIVKASK------NKQ-ELSFYSIPEFD------------EWKKHIENQ-KAWKIKYYKG
LGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQR
RLHGLPEQ-FLYGTATKHLTYNDFINKELILFSNSDNERSIPSL------VDASKL----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|7025462|gb|AAF35892.1|	   226 residues, 50 /line  topoisomerase II [Mytilus edulis]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------GS-HIKGLLINFVHHFWPNL------LK-NNVVEEFIT
PIVKVTK------GKE-EKSFYSLPEFE------------EWKRDTDNW-HTYKVKYYKG
LGTSTAKEAKEYFSDMDKHKIPFKYQGTEDDASITLAFSKKKIEERKEWLTNFMVERKRR
LEMGLPEV-YLYGKETKHISYNEFINRELVLFSNMDNERSIPSL------VDGLKPGQRK
VIFTCIKRNLIRELKVAQLAGSVAEQSSYHHGEQSLMSTIINL-----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------
>gi|72176533|ref|XP_789474.1|	   123 residues, 50 /line  PREDICTED: similar to topoisomerase II alpha-2, partial [Strongylocentrotus purpuratus]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------MENAEINNIMEILGLKYGNK-YD
SPESMRSLRYGKLMIMTDQDPDGS-HIKGLLINFIHSNWPHL------LQ-MNFLEEFIT
PIVKVSK-----ANET-KLPFYSLLEFE------------KWKNETYNW-KSWKVKYYKG
------------------------------------------------WL----------
------------------------------LFSQEV------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.