Fandom

Proteins Wiki

At2g13690.1/MSA

< At2g13690.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|18397316|ref|NP_565358.1|	   544 residues, 50 /line  PRLI-interacting factor, putative [Arabidopsis thaliana]
MT----------------------------------------------------------
MGDSDLRKP---------------------------------------------------
--------------TNFGTGH---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------LSRRRSWCCSFA---VPPASPDTRSISSR-NHIPAKSQQQR
----------------PKLVPCSPQSSKSALNIVNRIDPRRILSP----GRVSPIDSDPT
VTTMQETETTQ-----------EEEDDAVVVDSTP--NLRSESFRAPKIEVTGSGLSEGY
DARLSLKGRNGGGVLVLELSLEVLAANSDVFSGLIAEE---KKCSS--SSSS-LGLKNTC
RIEVCDVENLGVFRETVELMFEE----SNVIIKKFMTMGVYRAIDVLEVAAGIKFSRAVL
SCLKYLEAVPWT-EDEEEKLRRLLGIYSFDDDAVSEILARFNSNETENLQ----------
---------DSLSKKLVWSITSCSDVNPRNELKSLVKGLLCKSSVYEKEQ--PEINKEDI
YRAGKCCVDS-LAKLFEEGSSSSS----SK-------KEKPLIESISREVENINW-----
-----------------------------------------LLEIMIDREIAEEFVE---
----IWGKQRRL----------VEMHERVSPMVRYEVSRVTGAIFIAMGKRRVQCGGEA-
-----RAGLVEA---WFKPMLVDFGW---LQR-CKKGLDMREVEEGMGQTLLTLP-----
-VKEQYQVFMEWFRWFSKHGTECPNLSKAFQIWW--------------------------
----------------------------RRSFLRG--------------VESSTC-----
--------R
>gi|108862274|gb|ABA96017.2|	   602 residues, 50 /line  f13j11 PRLI-interacting factor G, putative, expressed [Oryza sativa (japonica cultivar-group)]
MPTPG-------------------------------------------------------
SSPVATAAA---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------HRHRRSRRRHPQG--------------------------------
------------------------------------------------------------
-------------------PPPRQPWCCSFALDP----------LSAVHR-SPAGTTTAA
------PPP----------HHRRRSKHAAT-TAPPL--SRRMRSP----GRVSPVDDATA
YGGAAASASA-CSSARLSSVSECP--PPPPPP---LPRPRPP-------------PPAVE
ALRIRLVSK---G-VILEVAEVERVRRECRVV------------GRILG-GGG------G
EVAVEGKVEVEAIREAVEMMLEDADEAA--AMRRLSRAGVARAIAVLEVSFSLMFDRGVT
NCLKYLEAVPWS-EPEEERIKSLLSQYPCNKTVSQDLLARLQPQEPSSSA----------
----------ELVVELMDSITKGTNNNARKDLRTLVDGILSRTSIYIKSD--KELDMMNI
YSICHTCLNC-LVELFGEASDLGP----SGQTTI--SVGKGPHERICKQVENLTW-----
-----------------------------------------LLQILIDRQMGEEFVD---
----LWASQNTL----------STMHERFSPMVRYELSRISATIFIAMGSGKLHCTSTS-
-----RLGIFEA---WFRPLLVDFGW---LRR-CPKGLNMATLEDGIGQALLTLT-----
-LKHQQVLFMEWFETFSGQGRECPNLMRAFQVFSLIIQPNGQLYHMLPQTPQQPQQPQHT
MEQHMGQPDQSGPGQMLHASNVVKLEPQQLQALRSLGAVKMEHQSSDSQTHTCSCSS---
--NNNICCS
>gi|108862909|gb|ABA99196.2|	   513 residues, 50 /line  expressed protein [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
MEETRAKRV---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------DAS-ARMRAVPIA--------------------------------
------------------------------------------------------------
-------------------VTPEGFWCCPSPAAL----------HKSLKNNPHHHGGGGN
------HKP--------PPPTPPPQQ-----------------------------HKTTT
PSAPPSRAPS-VLSEPV--AGDAP--DEPPPQ---PAAAE-AEAERHKICVGFG-QPETS
DVTVVLYGKEGIA-VRMSVHGDVLRRSSAFFAEKLSSS---SSSSGSGGHGHG------S
CLEIHDCDDAEIYVETVGLMYCD----E--AKHKLLKQNVSRVLRIMKVAESLGFHACVK
SCLDYLEAVPWV-GEEEDNVVSSIRHLQSKAYGVSPLLKRITSDNLKSPT----------
----------DTLALIMEMVLKSTDDRARREMKALVLNLLKDSNHCTDGS--SDISSELL
YSSCQGCLDR-LRLLFSEATGQEF----SVE----------LTRQITLETDNLLW-----
-----------------------------------------LVEILVNQRICDDFVA---
----LWANQSKI----------AELHGKLPVASRHTVSCITARLFVGIGRGEMLPSKNT-
-----RLLLLQV---WLQPLIDDYSW---LQC-SCRSFDRKLVEEGIGQTILTLP-----
-LEDQRSMLLAWLGRFLKLGDNCPNLQRAFEVWW--------------------------
----------------------------RRTFVRP--------------YVSQARCG---
--------G
>gi|115470399|ref|NP_001058798.1|	   581 residues, 50 /line  Os07g0123500 [Oryza sativa (japonica cultivar-group)]
MHEQGCNVRF-----CGLNGLESLILVVESCKFGYSF-ILIPKGCAIVPIIRYRLLLKTS
MEEFRFGRL---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------DGQPAKIRNVPIA--------------------------------
------------------------------------------------------------
-------------------VTPEGFWCCPSQAIL----------QKSMKNQNQHARPKGG
------ASP--------SVSKASSVQ----------------RTP----TISLEKRTHST
PTRSRTNSDE-QVLPPA--DDAIP--DQPKVS----PVPDKRHNKQHKISVGFG-QLHTS
DLKVMLYGREGVA-VKMIVHKNILAENSTFFADKLSRQ---SPV---------------S
CIEVSDCEDVEIFVETVGLMYCK----D--VKQRLIKQAVARVLRILKVAESLGFPTCIM
SCLNYLEAVPWV-GDEEENVLSSIRQLHCENYGVSPLLKRVASDLTNPPS----------
----------DTLAHIIELVLKSSDDRGRREMKSLVLKLLKENNIWTNGS--SDSCVVTF
YSSCRNCLES-LSNLFRQASEPEF----SEQ-SS--DSKEVIFRQITLEADNLLW-----
-----------------------------------------LAEILADRNAADELTS---
----IWASQGEL----------AKLHCRIPVMHRHLISCVTARLFVAVGKGEALPSKET-
-----RQLLLDV---WLQPLMDDYNW---LQH-GCRWFDRKVIEEGIGQTILTLP-----
-LEDQQSILLTWLGRFLKVGDSCPNLQRAFEVWW--------------------------
----------------------------RRTFVRP--------------YTDQQASS---
--SSQSRWS
>gi|125545845|gb|EAY91984.1|	   522 residues, 50 /line  hypothetical protein OsI_013217 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
MTEFKVGSL---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------DARATKIRNVPIA--------------------------------
------------------------------------------------------------
-------------------VTPEGFWCCPSQAVL----------QKTMKNQNQQAKPKGG
------ASP--------LASKASSVQ----------------RAP----TISSERRAHST
PTRSRINSDE-QKCAPA--ENSTP--NPPKVA---NDRPQK----QHKISVGFG-QLEMS
DLKVVLYGKDGVA-VKMSVHRNILAENSTWFADKLSRQ---SPM---------------S
SMEVPDCEDVEIYVETVGLMYCN----D--AKQRLIKQSVPRVLRILKVAELLGFQACVL
SCLEYLEAVPWV-GEEEENVVSSVQHLQSGNYGVSPILKRVCSDLTSPPN----------
----------DTFVHIIELVLKSGEDRGRREMKSLVLKLLKENSSCTSTS--VDIYAETL
YSSCQNCLES-LLTLFRQATADDF----AEQ-SL--DLKEPVFRQIALEADNLLW-----
-----------------------------------------LTEILADRNAAGEFAV---
----MWSNQGEL----------AELHSKLPTKSRHLVSCVTARLFVAIGKGEMLPSKDT-
-----RKLLLDV---WLQPLMDDYNW---LQH-GCRSFDRKVVEEGIGRTILTLP-----
-LEDQQTILLSWLGSFLKVGDSCPNLQKAFEVWW--------------------------
----------------------------KRTFVRP--------------YVEQGNQS---
----QPGRS
>gi|114640561|ref|XP_001158924.1|	   462 residues, 50 /line  PREDICTED: hypothetical protein isoform 1 [Pan troglodytes]
---------------------------MERDSHGNAS-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------PARTPSAGASPAQ--------------------------------
------------------------------------------------------------
--------------------------------------------ASPAQA-SPAGTPPGR
------ASP----------AQASPAGTPPG-RASPAQASPAQASP----AQASPARASPA
LASPSRSSSGRSSSARSASVTTSP--TRVYLV---RATPVRAVPVRSS--PARS-APATR
ATR---ESS---G-TSLPKFTWREGQKRLPFI------------GCVL------------
-------LLIALVASLIILFQFWRGHTG--IRYKEQRESCPKHAVRCDGVVDCKLKSDEL
GCVRF------------DWDKSLLKIY--SGSSHQWLPICSSNWNDSYSE----------
----------KTCQQLGFESAYRTTEVAHRDFANSFS-ILRYNSTIQESL--HRSECPSQ
RYISLQCSHCGLRAMTGRIVGGAL----ASD------SKWP--WQVSLHFGTTHICGGTL
IDAQWVLTAAHCFFVTREKVLEGWKVYVGTSNLHQLPEAASIAEIIINSNYTDEEDDYDI
ALMRLSKPLTLS----------G-------------------------------------
GYTKEMLQ--------------RFSE---DH-----------------------------
--------------------CGQGTSKKT--SFI--------------------------
----------------------------HSFTHHS---------SIHSFVHLSNTIW---
--PA----L
>gi|114640563|ref|XP_001158977.1|	   476 residues, 50 /line  PREDICTED: hypothetical protein isoform 2 [Pan troglodytes]
---------------------------MERDSHGNAS-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------PARTPSAGASPAQ--------------------------------
------------------------------------------------------------
--------------------------------------------ASPAQA-SPAGTPPGR
------ASP----------AQASPAGTPPG-RASPAQASPAQASP----AQASPARASPA
LASPSRSSSGRSSSARSASVTTSP--TRVYLV---RATPVRAVPVRSS--PARS-APATR
ATR---ESS---G-TSLPKFTWREGQKRLPFI------------GCVL------------
-------LLIALVASLIILFQFWRGHTG--IRYKEQRESCPKHAVRCDGVVDCKLKSDEL
GCVRF------------DWDKSLLKIY--SGSSHQWLPICSSNWNDSYSE----------
----------KTCQQLGFESAYRTTEVAHRDFANSFS-ILRYNSTIQESL--HRSECPSQ
RYISLQCSHCGLRAMTGRIVGGAL----ASD------SKWP--WQVSLHFGTTHICGGTL
IDAQWVLTAAHCFFVTREKVLEGWKVYVGTSNLHQLPEAASIAEIIINSNYTDEEDDYDI
ALMRLSKPLTLS----------GE--GICTPR----------------SPAPQPQHPLQP
SHLSASVN--------------SYPG---PK-----------------------------
--------------------ASAGQKSKT--LKD--------------------------
----------------------------PYMEHFC---------FI-----IRETEA---
--QG----L
>gi|116256363|ref|NP_001070731.1|	   567 residues, 50 /line  transmembrane protease, serine 13 [Homo sapiens]
---------------------------MERDSHGNAS-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------PARTPSAGASPAQ--------------------------------
------------------------------------------------------------
-------------------ASPAGTPPGRASPAQ----------ASPAQA-SPAGTPPGR
------ASP----------AQASPAGTPPG-RASPGRASPAQASP----AQASPARASPA
LASLSRSSSGRSSSARSASVTTSP--TRVYLV---RATPVGAVPIRSS--PARS-APATR
ATR---ESP---G-TSLPKFTWREGQKQLPLI------------GCVL------------
-------LLIALVVSLIILFQFWQGHTG--IRYKEQRESCPKHAVRCDGVVDCKLKSDEL
GCVRF------------DWDKSLLKIY--SGSSHQWLPICSSNWNDSYSE----------
----------KTCQQLGFESAHRTTEVAHRDFANSFS-ILRYNSTIQESL--HRSECPSQ
RYISLQCSHCGLRAMTGRIVGGAL----ASD------SKWP--WQVSLHFGTTHICGGTL
IDAQWVLTAAHCFFVTREKVLEGWKVYAGTSNLHQLPEAASIAEIIINSNYTDEEDDYDI
ALMRLSKPLTLS----------AHIHPACLPMHGQTFSLNETCWITGFGKTRETDDKTSP
FLREVQVNLIDFKKCNDYLVYDSYLT---PRM-MCAGDLRGGRDSCQGDSGGPLV-----
-CEQNNRW---YLAGVTSWGTGCGQRNKP-GVYT--------------------------
----------------------------KVTEVLP---------WI-----YSKMES---
--EVRFRKS
>gi|14042743|dbj|BAB55376.1|	   491 residues, 50 /line  unnamed protein product [Homo sapiens]
---------------------------MERDSHGNAS-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------PARTPSAGASPAQ--------------------------------
------------------------------------------------------------
-------------------ASPAGTPPGRASPAQ----------ASPAQA-SPAGTPPGR
------ASP----------AQASPAGTPPG-RASPGRASPAQASP----AQASPARASPA
LASLSRSSSGRSSSARSASVTTSP--TRVYLV---RATPVGAVPIRSS--PARS-APATR
ATR---ESP---G-TSLPKFTWREGQKQLPLI------------GCVL------------
-------LLIALVVSLIILFQFWQGHTG--IRYKEQRESCPKHAVRCDGVVDCKLKSDEL
GCVRF------------DWDKSLLKIY--SGSSHQWLPICSSNWNDSYSE----------
----------KTCQQLGFESAHRTTEVAHRDFANSFS-ILRYNSTIQESL--HRSECPSQ
RYISLQCSHCGLRAMTGRIVGGAL----ASD------SKWP--WQVSLHFGTTHICGGTL
IDAQWVLTAAHCFFVTREKVLEGWKVYAGTSNLHQLPEAASIAEIIINSNYTDEEDDYDI
ALMRLSKPLTLS----------GE--GICTPR----------------SPAPQPQHPLQP
SHLSASVN--------------SYPG---PK-----------------------------
--------------------ASAGQKSKT--LKD--------------------------
----------------------------PYMEHFC---------FI-----IRETEA---
--QG----L
>gi|115333977|gb|AAI22566.1|	   641 residues, 50 /line  PCLO protein [Homo sapiens]
------------------------------AAGGGASGAGSPSHTAI-PAGMEADLSQLS
--EEERRQIAAVMSRAQGLPKGSVPPAAAES-------------PSMHRKQELDSSHPPK
QSGRPPDPGRPAQPGLSKSRTTDTFRSEQKLPGRSPSTISLKESKSRTDLKEEHKSSMMP
GFLSEV-NALSAVSSVVNKFNPFDLISDSEASQEETTKKQKVVQKEQGKPEGIIKPPLQQ
QPPKPIPKQQGPGRDPLQQDGTPKSISSQQPEKIKSQP-PGTGKPIQGPTQTPQTDHAKL
PLQ----RDASRPQTK---QADIVRGESVKPSLPSPS-KPPIQQPTPG---KPPAQQPGH
EK---SQPGPAKPPAQPSGLTKPLAQQPG-TVKPPVQPPGTTKPPAQPLGPAKPPAQQTG
SEKPSSEQPGPK--ALAQPPGVGKTPAQ--------------------------------
------------------QPGPAKPPTQQVGTPKP-LAQQPGLQSPAKAPGP--------
------------TKTPVQQPGPGKIPAQQAGPGK----------TSAQQT-GPTKPPSQL
------PGPAKPPPQQPGPAKPPPQQPGSA-KPPPQQPGSTKPPP----QQPGPAKPSPQ
QPGSTKPPSQQPGSAKPSAQQPSP--AKPSAQ---QSTKPVSQTGSGK--PLQP-PTVSP
SAK---QPP---S-QGLPKTICP-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------LCNTTELLLHVP-----
-EKANFNTCTECQTTVCSLCGFNPNPHLTEVKEW--------------------------
---------------------------------LC-----LNCQMKRALGGDLAPVP---
--SSPQPKL
>gi|13874522|dbj|BAB46880.1|	   553 residues, 50 /line  hypothetical protein [Macaca fascicularis]
MGNEASLEGE-----GLPEGLAAAA-----AAGGGASGAGSPSHTAI-PAGMEADLSQLS
--EEERRQIAAVMSRAQGLPKGSVPPAAAES-------------PSMHRKQELDSSHSPK
QSGRPPDPGRPAQPGLSKSRTTDTFRSEQKLPGRSPSTISLKESKSRTDFKEEHKTSMMP
GFLSEV-NPLSAVSSVVNKFNPFDLISDSEASQEETTKKQKVVPKEQEKPEGITKPPSQQ
QPPKPVPKQQGPGRDPLQQDGPPKSISSQQPEKIKSQP-PGTGKPIQGPAQTPQTDHAKL
PLP----RDASRPQTK---QADIVKGESVKPSLQSPS-KPPIQQPTPG---KPPAQQPGP
EK---SQPGPAKPPAQPPGLTKPLAQQPG-TVKPPVQPPGTAKPPAQPLGPAKSPAQQTG
SEKPSLEQPGPK--TLAQPPGVGKTPAQ--------------------------------
------------------QPGPAKPPTQQVGTPKP-LAQQSGLQSPAKAPGP--------
------------TKTPAQQAGPGKIPAQQAGPAK----------PSAQQT-GPTRLPSQL
------PGPAKPPSQQ---------------------PSSAKPPS----QQPGSAKPPPQ
QPGSAKPPSQQPGSAKPSAQQPSP--AKPLAQ---QSTKPVSQTGSGK--PLQP-PT-SP
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------
>gi|115455033|ref|NP_001051117.1|	   478 residues, 50 /line  Os03g0723600 [Oryza sativa (japonica cultivar-group)]
--------------------------MSLRKRQRSAS-----------------------
------------SSRLSTLS----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----SSPAPHTAAAAASASS---------------------------------------
---PPLSFPNA-------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------DL
------VLRLHLDPCPD-------------------------------------------
-----------------------------------------------------------D
DADLDAGEDHRPS-LDLHVSSASLL-RSRYFAALLSDRWSPAPTSAAGGHGHL---SLAV
AAPRSASHPFHAHVEVVRLLHTL----D--FAGAI--HSPADALDILPVALQLLFDACVE
ACTRFLEAVPWS-PDEEARVLEIAPLLPADE--AADLLARITPPPAASAS--------AA
GGEAARSPSEAMLHGLIHSAIHGHPVPA--ATKAFVAMLLKDYPSR-------DCVQKVL
DEAFLSRLET-VKELMGKYASPDFRVAVDSDERD--AIQRLNLQSAVLNVRHLLW-----
-----------------------------------------LIERMVEMRVAGNAVK---
----LWSEQAALTADLQKLLNDVDMWKNITPGLPVLVTRCTLRFANSVVNGETIVPRQV-
-----RTKLVRS---WLPVLNVCRNMVQPMQC-GYKSPNCQELEETFLQIISTLP-----
-VPDAQELLQQCLGFSTRNVDDCPHLIAAFKTWF--------------------------
----------------------------RRAGRAP-------------------------
----QGAEN
>gi|125587756|gb|EAZ28420.1|	   478 residues, 50 /line  hypothetical protein OsJ_011903 [Oryza sativa (japonica cultivar-group)]
--------------------------MSLRKRQRSAS-----------------------
------------SSRLSTLS----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----SSPAPHTAAAAASASS---------------------------------------
---PPLSFPNA-------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------DL
------VLRLHLDPCPD-------------------------------------------
-----------------------------------------------------------D
DADLDAGEDHRPS-LDLHVSSASLL-RSRYFAALLSDRWSPAPTSAAGGHGHL---SLAV
AAPRSASHPFHAHVEVVRLLHTL----D--FAGAI--HSPADALDILPVALQLLFDACVE
ACTRFLEGETWS-AEQEGPGPRDRAFFPADE--AADLLARITPPPAASAS--------AA
GGEAARSPSEAMLHGLIHSAIHGHPVPA--ATKAFVAMLLKDYPSR-------DCVQKVL
DEAFLSRLET-VKELMGKYASPDFRVAVDSDERD--AIQRLNLQSAVLNVRHLLW-----
-----------------------------------------LIERMVEMRVAGNAVK---
----LWSEQAALTADLQKLLNDVDMWKNITPGLPVLVTRCTLRFANSVVNGETIVPRQV-
-----RTKLVRS---WLPVLNVCRNMVQPMQC-GYKSPNCQELEETFLQIISTLP-----
-VPDAQELLQQCLGFSTRNVDDCPHLIAAFKTWF--------------------------
----------------------------RRAGRAP-------------------------
----QGAEN
>gi|115457512|ref|NP_001052356.1|	   527 residues, 50 /line  Os04g0278000 [Oryza sativa (japonica cultivar-group)]
----MADAAH-----HL------------RRR----SSAALPRG----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------WCCSFS--------------------------------
-------------------ATPQSPDH--------------------HRPLS--------
------------AASAAGGEGVGGGGA---------------------RGKLPPKSPSVS
------LPS----------FQSSPSS-----RLAGFIDPRRILSP----GRVSPIDPDGS
-------PAVAAGANSEEDATP---------------RPSVP-FVAVREEREEE-EGRGL
DLKLCLRGRDGRS-VAMELDSAVLCESSAFFAAMAPP-----PEAT--VGGGS------K
RIEVDGVENVEAFKETVELMFEA----D--PMRWFVRAGVSRAIGVLEVSSSIMFDRGIK
SCLEYIEAVPWN-ENEEEKLKNLFARCTFDEAVSKDVLARLKPQCQSISD----------
----------DVTVHLIQSVTSSTNTGARKEMQSLVNGLLSRSSVYQKDL--SGLNKGSL
YQICCSCLNS-LVEHFTEDLCSDK----------IVRDSKPMIERVSKQTENLNW-----
-----------------------------------------LFDILVNNDMAEEFVE---
----LWAKQEDL----------ISMHGQASAMFRYELSRISANVFIVLGKGKVQCPSDL-
-----RSQLFYG---WFRPMLMDFGW---LQR-CSKGLDMRMLEENLGQALLTLP-----
-LQQQQSLFEEWFQCFASRGTECPNLSRAFQVWW--------------------------
----------------------------RRSFVRS--------------SLESRR-----
---------
>gi|115471445|ref|NP_001059321.1|	   564 residues, 50 /line  Os07g0259700 [Oryza sativa (japonica cultivar-group)]
MEGGGAQRHH-----RG------------RRRGAAGSAARTPRG----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------WCCSFA--------------------------------
-------------------GVPQSPDLRPF---------------PPSLAPP--------
------------ATAASSSPAPGGGAG---------------------RNKLPPKSPSIS
--------S----------FHSSPTSSRLA-GLGGLIDPRRILSP----GRVSPIDLDDS
-----APPLPLPLPLPPPPVTPAAETVVVPAE---TSAAVAP-LVVASAEADAA-GDEAL
DLRLFLRGRDGSTCVVMELDSGVLCDSSAFFAAMAPPR---GPAGD--GGGSG------R
RIEVDGVDNVEAFRAAVELMYQP----D--PLRWLAAAGVSRSIDVLEVSSSIMFERGVK
LCLSYIEAVPWN-ENEEEKLKNLFARCTFDEAISQDVLARLRPHSWSSSE----------
----------DLTVHLIQSVTSSTNSGARKDMQSLVNGLLSKSSVYQKDM--AGLNRESL
YNICYACLNS-LVDLYDEATEATN----HTAQALVIKGSKPFIERISQQTENLNW-----
-----------------------------------------LLDILVNIDMAEEFVE---
----LWAKQDRL----------IRIHEQASPMMRYELSRISASVFIALGKGKVQCRGEL-
-----RSLLFYG---WFSPMLLDFGW---LQR-CSKGLDVRSLEENLGQALLTLP-----
-LKQQQCLFEEWFQCFASKGSECPNLTRAFQVWW--------------------------
----------------------------RRSFVRS--------------SVEGQ------
---------
>gi|125599759|gb|EAZ39335.1|	   502 residues, 50 /line  hypothetical protein OsJ_022818 [Oryza sativa (japonica cultivar-group)]
MDQSHAVHSE-----CH------------S------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------TDSPTSSRLA-GLGGLIDPRRILSP----GRVSPIDLDDS
-----APPLPLPLPLPPPPVTPAAETVVVPAE---TSAAVAP-LVVASAEADAA-GDEAL
DLRLFLRGRDGSTCVVMELDSGVLCDSSAFFAAMAPPR---GPAGD--GGGSG------R
RIEVDGVDNVEAFRAAVELMYQP----D--PLRWLAAAGVSRSIDVLEVSSSIMFERGVK
LCLSYIEAVPWN-ENEEEKLKNLFARCTFDEAISQDVLARLRPHSWSSSE----------
----------DLTVHLIQSVTSSTNSGARKDMQSLVNGLLSKSSVYQKDM--AGLNRESL
YNICYACLNS-LVDLYDEATEATN----HTAQALVIKGSKPFIERISQQTENLNW-----
-----------------------------------------LLDILVNIDMAEEFVE---
----LWAKQDRL----------IRIHEQASPMMRYELSRISASVFIALGKGKVQCRGEL-
-----RSLLFYG---WFSPMLLDFGW---LQR-CSKGLDVRSLEENLGQALLTLP-----
-LKQQQCLFEEWFQCFASKGSECPNLTRAFQVWW--------------------------
----------------------------RRSFVRS--------------SVEVNL-----
-----VTSK
>gi|115460090|ref|NP_001053645.1|	   533 residues, 50 /line  Os04g0579700 [Oryza sativa (japonica cultivar-group)]
MD---------------------------------PP-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------PQPPTSYPSSYT---------------------------------------
------------------------------------------------------------
--------------------------------KFN-SALNAGLLNPMSPPPL--------
-----------P--LDKTR----------SSPTL----------FDMMANEQD-------
--------------YHPRTAAAIH------------------SIP----APPQQAHPLQ-
---PARS---------------MDRQVL-------LQDRVAELIGSCSPGNQFN-DADSS
DVRLTLTSKDGLS-VTLCVHRHILVAHSRFFAAKLSDR---WSKQ---QRTLP------H
IVEISDCDDVEVYVETLRLMYCK----D--LRRRLMREDVSKVLGILKVSAAIVFDAGVL
SCLEYLEAAPWA-EDDDEKVAALLTQLHLENSGAGEVLKRVSLELAPSAVAEEVEVGSGC
NGGGNSGGGEEVLVRLLQVVLEGKDEKARREMKGLVSKMLRENSTSRGGAIGGDLRKESL
YSACNGCLRL-LHEQFEMAAGGDQ----SE------------VAQIARQADNLHW-----
-----------------------------------------MLDILVERQIAEDFLR---
----TWAMQIEL----------AELHGKVPAIHRYEVSRVTARLFVGVGKGQILVSKEV-
-----RCQLLST---WLEPFYEDFGW---MRR-ACKGLDRHLIEDGLANTILTLP-----
-LATQQEILLAWFNRFLNSGEDCPNIQRGFEVWW--------------------------
----------------------------RRAFWKR--------------NGEPEQPPRLR
ITA-ICENS
>gi|15222554|ref|NP_176570.1|	   548 residues, 50 /line  PRLI-interacting factor-related [Arabidopsis thaliana]
MDYSTATTT------------------AGNGY----S-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------SPRDSSFPSSFT---------------------------------------
------------------------------------------------------------
--------------------------------KFN-SALTAGLLNPMSPPPP--------
-----------PAMHDKTR----------SSPTL----------FEMMASEAD-------
------------------TIGKVPVQIHNG------------VLP----SPSSSSSSSSA
AATAARTT-----NVNHLVISAQDKQAL-------AMQRISDLLVIRSPGNQFN-DPNSS
DVKLTLSSKDGIS-ITMCVHRQILVAHSRFFAMKLSDR---WSKQQLPPSSSP------Y
IVEISDCDDVEVYIETLMLMYCR----D--LRKKMMRHDVSRVLGILKVSAAIGFDAGVL
SCLEYLEAAPWS-EDEEYRIASLLSELHLENVGATEVLRRVSVEASN------------G
NNGSNGGSNDEVLLNLLHIVLEGKDEKARRDMKTLVSKMLRENSSG------NDLRKESL
YLACDGCLHK-LKRQFLQAAESDL----EN------------VDQIARQADNLHW-----
-----------------------------------------ILDILIDRQIAEDFIV---
----MWASLSEL----------SEVHSKVPVVHRFEISRVTARIFVGIGKGQILTPKEV-
-----RCLLLRN---WLTPFYDDFGW---MRR-ASKGLDRYLIEDGLSNTILTLP-----
-LAWQQEFFLAWFDRFLNSNEDCPNIQRGFEVWW--------------------------
----------------------------RRAFWRR--------------KEQSQEPARLR
VTASATENS
>gi|38230508|gb|AAR14275.1|	   533 residues, 50 /line  predicted protein [Populus alba x Populus tremula]
MDFTTTTTT------------------LTNGHHHVAS-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------PNEHPSFPSSFT---------------------------------------
------------------------------------------------------------
--------------------------------KFN-SALTAGLLNPMSPPPP--------
-----------D---HKPR----------SSPDP----------FEMMASEPE-------
--------------MQPKAITQMPINAYNG------------NIS----FRNTQSSQ---
-------------------MSVQDRQAL-------ILQRITDILGNRSPGNQFN-DSNSS
DVKLTLSSKDGIS-VSMDVHRQILVGHSRFFAVKLSDK---WSNKQ-QRMSTP------Y
VVEIADCDDVEVYIETLRLMYCK----D--LRRKLMKEDVSRVLGILKVSAAIGFDAGVL
SCLEYLEAAPWA-EDEEEKVASLLSELRLEGVGAGEVLKRVSVEVTH------------G
--AGDRSDNEEVLLKLLHVVLEGKDEKARREMKGLVSKMLRENSSQ------NDLRKESL
YLACNGCLQL-LQDHFLRAASGDL----ND------------VGLVARQADNLHW-----
-----------------------------------------ILDILIDRQIAEEFLK---
----TWASQSEL----------SDVHSKIPAVHRYGVSRVTARLFVGIGKGQLLASKEA-
-----RCLLLQT---WLVPFYDDFGW---MRR-ASKGLDRHLIEDGLSNTILTLP-----
-LAWQQDIFLAWFDRFLNSGEDCPNIQRGFEVWW--------------------------
----------------------------RRAFWRR--------------SGEHERTRPIR
ITTATIENS
>gi|121602816|ref|YP_988483.1|	   497 residues, 50 /line  TolA domain protein [Bartonella bacilliformis KC583]
MKWSLAFSFAAHILFLILGMMHFIHLPSLPSHQ---------------------------
--------MEAVSITLAPLSQELSLQQGSL------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------SAPPDESPAPKPTTK
PQE---KEQARHVGDG---KMDL--------AAPLKK-REKPRQIDAA---SPTFGEKDA
AE------LPVLPQKTQEERAQPELTQPE-SVQPKPAKPEPAQPEPTQPEPTQPESAQPK
---------------PAKPEPAQPEPTQ--------------------------------
-------------------PEP--------------------------------------
------------TQPESAQPKPAKPEPAQPEPTQ----------PE------PTQPESAQ
------PKPAKPKP-----AQPEPTQPEPT-QPESAQPKPAKPKP----AQPEPTQPEPT
QPESAQPKPAKPKPAQPEPTQPEP--TQPESA---QPKPAKPKPAQPE--PIQP-KPAPA
I-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----IPPPLKPLPETAPLPRVKAKAPSKRPQQT--------------------------
------------AQALPPKGEQTIEDIL------------------ALEKNDLIN-----
-----------------------------------------RARTQGGGAKRSQKPE---
----ATGAKKDV----------NASERMAQTLVNLAGACIQNKLRLVAIGGNLQNRPIV-
----------------RLQFQLDNNG---MVR-GTPIIDPLQGD----------------
--ESQKTIMTRQVYAAVFACQPYADLPRDQYNLW--------------------------
----------------------------GQGFDFN-------------------------
VDPLQGQAP
>gi|125805446|ref|XP_001345478.1|	   488 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
------------------------------------------------------------
------------------------------------------------------------
------------MPPYEDDWNLYRFVEEALLIAGSPLSVALKEEN---------------
---PQE-GGLSRWQQRGIFLGPDDLT------------------KGKRREAGLEVRTYPR
RVAIRIPFSE-PLESLLKLCETSASA------------------------LCPQCLPVSA
PVP----EQAPSPDDTALTSQTTRRGRRRKRTAPAPE-RPPVSAPGPE---RPPVSAPAP
ERPPVSAPAPERPPVSAPGPERPPVSAPG-PERPPVSAPAPERPPVSAPAPERPPVSAPA
PERPPVSAPAPERPPVSAPAPERP------PVSAPGPERP--P---------------VS
APAPERP--------PVSAPAPERPPVSAPAPERP-PV---------SAPAPERPPV---
-----------------SAPAPERPPVSAPAPER-PPVSAPAAERPPVSA-PAAERPPVS
APRPPVSAPAQLPPVPPAPAQLPPVPPAPA-QLPPVPPAPAQLPP----VPPATAQLPPV
PPAPAQLPPVPPAPVQLP------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------LQLALLGSPALCF----
-------------------------------------------LHDHPWVIPPAPPWWSS
PF-RTDSPAAPWLPAGAPDPQTDPDLALPSLPLF--------------------------
----------------------------LLRSAP-------------PLGTSLGASG---
------RG-
>gi|125844672|ref|XP_001332818.1|	   511 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
------------------------------------------------------------
------------------------------------------------------------
------------MPQYEDDWNLYRFVEEALLIAGSPLSVALKEEN---------------
---PQE-GGLSRWQQRGIFSGPADLT------------------KGKRREAGLELRTYPR
RVTRRIPFSE-PLESLLELCETSASA------------------------LCPQCPPVSA
PVP----EQAPSPDDTVLTSQTTRRGRRRRRKAPAPE-RPPVSAPVPE---RPPVSAPAP
ERPPVSAPAPERPPVSAPAPERPPVSAPA-PERPPVSAPAPERPSVSAPAPEHPPVSAPA
PERPPVSAPAPERSTMPVPVWLLALPAPPRFLALPAPPRL--LPLPAP-----PRL--LA
LPAPTRR---------LALPAPTRR-LALPAPPRL-LALPAPPRL-LALPVPARLLAL-P
TPSRRLALPAPPRGL--ALPAPVQLPPVPPAPAQ----------LPPVPP-APAQLPPVP
------PAPAQLPPVPPAPAQLPPVPPAPA-QLPPVPPAPAQLPP----VPPAPVQLPPV
PPAPVQLPPVPPAPVQLP------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------LLLALLGFPALCF----
-------------------------------------------LQDRPWVIPPAPPWWSS
PF-RTDSPAAPWLPAGVPDP----NLALPSLPLF--------------------------
----------------------------LLRSAP-------------PLGTSLGVSG---
--SRSLEGG
>gi|68354644|ref|XP_695190.1|	   621 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
MDSADS--------------------IIVRIKQGNRSIER----------YIKEFLELAP
--------------------------KSSHS-------------DLLLMM---------F
FRGGLLDPVRSLMPPYEEDWNLYRFIEAALLIAGSPLSVALREEN---------------
---PQE-GGLSGGQQRGIFSGPADLT------------------KGKRREAGLELRPYQR
RAVRRSPFSE-PLESLLELCGTPVSA------------------------PVPQCPPVSA
PAP----EQAV---NYALPSQTTRRRRRRNRTAPAPE-RPPVSAPAPE---RPPVSAPAP
ERPPVSAPAPERPPVSAPAPERPPVSAPA-PERPPVSAPAPERPPVSAPAPERSTMPVPV
---PPLALPAPPRL--------LALPAPPRLLALPAPPRLLALPAPPRHLALLDPVRLQA
LPVSVRLFALPTSLGLLVLPAPVQLPSVSPAPVQLPPVPPAPVQLPLVPPAPVQLPPVPP
APVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPAQLPPVPP-APAQLPPVP
------PAPAQLPPVPPAPAQLPPVPPAPA-QLPPVPPAPAQLPP----VPPAPAQLPPV
PPAPAQLPPVPPAPAQLPPVPPAP--AQLPPV---PPASAQLPPVPPA--PAQL-PP---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------VPPALLKTPALCP----
-------------------------------------------LRDHPWVIPPDPPWWSF
PLLGTDSPAAPWLPAGVPDPQTDPDMTLPSLPLF--------------------------
----------------------------LLCSAP-------------PLGTSLGASG---
--SRSLEGG
>gi|15230303|ref|NP_190647.1|	   520 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
MAEIKNAKV---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------EQRQTKIRNVPVA--------------------------------
------------------------------------------------------------
-------------------VTPEGFWCCPSPVAF----------QKTLKSHNSLTKHK--
------------------------------------QSSPALQPP----KPEK--KPSST
TIRSVIASDE-TQQNLG--SFDTVHSIAVPATVQERPQRQKVETLPRKVAIEFG-EPGSS
DAKVILVGKQGFC-VKLSVHKKVLVDHSCFFAKKLAEK---DSV--------------FA
CLEIESCEDAELYVETIGLMYCK----D--MKQRLMKQNVSRVLRVLKVAELLGFSSCIQ
SCLDYLEAVPWVGEEEEEKVISSILRLKTEGVGVTPVLKRVASNAVDPPK----------
----------ETLSRIIELVLRSKEEKSRREMKSIVLKLLREQNG--ANV--ADNFNDTI
YSSCQTCLDS-VLSLFKQASEGEK----PET----------DTKQIAVEADNLTW-----
-----------------------------------------LLDVLAERQAAEEFSV---
----TWANQKEL----------ALLHEKLPLMSRYHISRVTSRLFIGIGRGELLPSKDT-
-----RLLLLTT---WLQPLFNDYNW---LQH-GCRSFDGKLVEEGIGRTILTLP-----
-LEDQQSILLSWLGSFLNGGDGCPNLQRAFEVWW--------------------------
----------------------------RRSFIRP--------------YSDRQANGSCQ
TDS-TSKEE
>gi|15238599|ref|NP_200813.1|	   499 residues, 50 /line  PRLI-interacting factor-related [Arabidopsis thaliana]
MASREVSTM------------------IKQGFIAD-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------PSLSFSPSRI---------------
--SSPIKLSTASPPLP-PPPPPPPNEST-----------------------------LSN
PTLFDMMSDEHNRE--------------LPRRKSH--ARVAQILTEFKNGVVYGHSLGPG
DVKLTVVGKDGYR-VTMDVHRKVLSEKSRFFMEKMNSR---REK------GVS------H
MVEISECDDLEIYVETVVLMYSD----D--LKKKLIGENVIKILALLKVSAAISFDEGVM
SCLEHLEAVPWS-EDEEETVVTCLEELHLPDDSVTLILQRVSSQPSTSST----------
-----RTRTDDIFSKLLTGVLQAKDDKARREMKVLIFKLVREEAD-------YDVSRDTL
YGLCHRCLTS-LVLCLSEVTTQ-MND--------PGKDRGALMGEIAREADNMLW-----
-----------------------------------------MVDILIEKKLCSEFVK---
----LWADQKEL----------ANLHSKIPTMYRHEISKITAQICVGIGKGRILVNRET-
-----RFAVLNT---WLEALYDDFGW---MRRLSSRSLDRKLVEDGLSQTILTLS-----
-LRQQQVILMKWFDRFLSKGDDCPNVQRAFEVWW--------------------------
----------------------------RRAFIRQ--------------VLTEPDEPRLQ
ITL-----Y
>gi|21553858|gb|AAM62951.1|	   543 residues, 50 /line  unknown [Arabidopsis thaliana]
------------------------------------------------------------
MGDSDLRKP---------------------------------------------------
--------------TNFGTGH---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------LSRRRSWCCSFA---VPPASPDARSISSR-NHIPAKSQQQR
----------------PKLVPCSPQSSKSALNIVNRIDPRRILSP----GRVSPIDSDPT
FTTMQEADTTQ-----------EEEDDAVVVDSTP--NLRSESYRAPKIEVTGSGLSEGY
DARLSLKGRNGGGVLVLELSSEVLAANSDVFSGLIAEE---KKCSS--SSSSSLGLKNTC
RIEVCDVENLGVFRETVELMFEE----SNVIIKKFMKMGVYRAIDVLEVATGIKFSRAVL
SCLKYLEAVPWT-EDEEEKLRRLLGIYSFDDAAVSEILARFNSNETENSQ----------
---------DSLSKKLVWSITSCSDVNPRNELKSLVKGLLCKSSVYEKEQ--PEINKEDI
YRAGKCCVDS-LAKLFEEGSSSSS----SN-------KEKPLIESISREVENINW-----
-----------------------------------------LLEIMIDREIAEEFVE---
----IWGKQRRL----------VEMHERVSPMVRYEVSRVTGAIFIAMGKRRVQCGGEA-
-----RAGLVEV---WFKPMLVDFGW---LQR-CKKGLDMREVEEGMGQTLLTLP-----
-VKQQYQVFMEWFRWFSKHGTECPNLSKAFQIWW--------------------------
----------------------------RRSFLRG--------------VESSTC-----
--------R
>gi|67473992|ref|XP_652745.1|	   543 residues, 50 /line  hypothetical protein 106.t00024 [Entamoeba histolytica HM-1:IMSS]
MPNPTVFIAF------------------------QQPIKKAI------VCNDLYDSV---
IRFGKIQRIICMNSHRPDMPHSLIEFESPESSNKCIEYLKTNPLPILNYKCRAEVSNAES
LNVKTESP-QAHDYTISPRFGHEAPITRVLLVNELPRYVTPQSPFHFYNLFSLYGSIIKV
NVLSEKRTAMIEYSSIEDTINAYQNLSNVKFFGSRLIVKH-------------SKHDSVA
APPGIWCKYFQPSKLLLHSTAPSVFVKFIQLHPIIACS-PNTPM-----ALCHYFDHYFV
PRPVDVFFDSPTSGVFAFKTTQDAVICVSILNNKNEN-GILLKLAFVS---EPPQVSPSN
IKYGYSQPHPM--------------------SRMSANQPILPAQPITPFQPMLLPQTIPS
QNLPPQSLPPQ-------------------------------------------------
----------------------------------------------------------NL
PPQSLPPQSLPPQSL--------------------PPQSLPPQS-------LPPQSL---
---PPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPP
QSLPPQSLPPQSLPPQSLPPQSLPPQN--------IPSQNIPSQSVSSQSLPSQSL----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
PPQNLPFQQSQLTNPYSSYKLESQNNNQPYSL----------------------------
-------------------------------------------------NETETTKPIKP
PTHYYNYSQ
>gi|45201234|ref|NP_986804.1|	   504 residues, 50 /line  AGR138Wp [Ashbya gossypii ATCC 10895]
MKFSLCSLGLALA-----------------TGSLAASDQNSV------IGRRAVSSGA--
--PMYSNSTLPASSTASGSSSSSI--------------------------PSAIASHSSE
VSSRPPTTTLKASTLVDYVTVTSFETVITSGVFSTNNFT------TTVDSVETITVTDCP
CVIPTTS----VRTATITSWNIVTELTTYCPSPTEIVTNGKTYTVTKPTTLTITDCPCSV
PVEKPPITITPPS---------------SQPQPSASKPQPSASKPESSA-SKPQ------
----------------------------PTASKPQPKPEPPVTVTTWNVVTELTTYCPAP
TSIVTNGKTYTVTEATTLTITDCPCSVPVITTHPPAPKPSTKEEPPKSSAPQ-PPASQP-
PVEPPKSSAP-----PAEPPKSSAPPAQ--------------------------------
------------------------------------------------------PPKSSA
PPAEPPKSSAPPAQPPKSSAPPAEPPKSSAPPAE-----PPKSSAPPAQP-PKSSAPPAE
------PPKSSAPPVEPPKSSAPPVEPPKS-SAPPAEPPKSSAPPAEPP----KSTAPPA
EPPKSTAPPAEPPKSTAPPAA--------------SQPPVQSTSTSVV------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------PTVPTV------
PVQS-------------SAGANKLAVGGVAGVLG--------------------------
------------------------------------------------------------
---ALAFII

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.