FANDOM


>gi|42570271|ref|NP_849953.2|	   1923 residues, 50 /line  CALS5 (CALLOSE SYNTHASE 5); 1,3-beta-glucan synthase [Arabidopsis thaliana]
-MAQSST-------------S----------HDSGPQGLMRR-PSRSA------ATTVS-
--------IEVFDHEVVPASLGT---IAPILRVAAEIEHERPRVAYLCRFYAFEKAHRLD
-PSSGG-------RGVR-------QFKTLLFQRLERDNASSL-----ASRV-KKTDGREV
ESFYQQYYEHYVR-AL---------D-------QGD-----QADRAQLGKAYQTAGVLFE
VLMAVNKSE---KVEAV-APEIIAAARDVQEKNEIYA--PYNIL--PLDSAGASQSVMQL
EEVKAAVAALGNTRGLNWPS----------GFEQHRKKTGNLDLLDWLRAMFGF------
----------QRDNVRNQREHLVCLFADNHIRLTPKPEPLN-------------------
-------KLD------DRAVDTVMSKLFK-----------------NYK------NWCKF
LGRKHSLRLPQ-AAQDIQQRKILYMGLYLLIWGEAANIRFMPECLCYIFHNMAYELHGLL
AGNVSIVTGENIKPSYGGDD-EAFLRKVITPIYRVVQTEANKNANGK------------A
AHSDWSNYDDLNEYFWTPDCF-SLGWPMRDDGD-LFKSTRDTT-------QGKKGSFR--
KAGRTGKSNFTETRTFWHIYHSFDRLWTFYLLALQAMIILAFER-VELREILRKDVLYAL
SSIFITAAFLRFLQSVLDVILNFPGFHRWKFTDVLRNILKIVVSLAWCVVLPLCYAQSVS
FAPGKLKQWLSFLPQ-VKGVPPLYIMAVALYLLPNVLAAIMFIFPMLRRWIENS-DWHIF
RLLLWWSQ-------------PRIYVGRGMHESQIALIKYTIFWLLLFCCKFAFSYFLQV
KLLVKPTNAIMSIRHVKYKWHE-FFPNAE---HNYGAVVSLWLPVILVYFMDTQIWYAIF
STICGGVIGAFDRLGEIRTLGMLRSRFQSLPGAFNTYLVPSDKTRRRGFSLSKRF-----
------------------------------------------AEVTAAR----RTEAAKF
SQLW----NEIISSFREE------------------------------------------
-----------------------DLISDREMDLLLVPY-TS-DPSLKLIQWPPFLLAS--
------KIPIALDMAAQFRTR---DSDLWKRICADEYMKCAVIECYESFKHVLHTLVIGE
NEKRIIGIIIKEVESNISKNSFLSNFRMAPLPALCSKFVELVGILKN-------ADPAKR
DTVVLLLQDMLEVVTRDMMQNENRELVEL--------------------GHTNKESGRQL
FAGTDAKPAILFP-PVATAQWHEQISRLHLLLTVKESAMDVPTNLEAQRRIAFFTNSLFM
DMPRAPRVRNMLSFSVLTPYYSEETVYSKNDLEMENED--GVSVVYYLQKIFP-------
------------------------------DEWTNFLERL-DCKDET---S---------
VLESEENILQLRHWVSLRGQTLFRTVRGMMYYRRALKLQAFLDMANETEILAGYKAISEP
TEEDKKSQ-RSLYTQLEAVADLKFTYVATCQNYGNQKRSGDRRA----TDILNLMVNNPS
LRVAYIDEVE-EREGGKV----QKVFYSVLIKA----------VDNLDQEIYRIKLPGPA
-KIGEGKPENQNHALIFTRGEALQAIDMNQDHYLEEALKMRNLLEEFNEDH-G-------
------VRAP--------TILGFREHIFTGSVSSLAWFMSNQETSFVTIGQRVLASPLKV
RFHYGHPDVFDRIFHITRGGISKASRGINLSEDIFAGFNSTLRRGNVTHHEYIQVGKGRD
VGLNQISLFEAKVACGNGEQTLSRDLYRLGHRFDFFRMMSCYFTTVGFYISSMIVVLTVY
AFLYGRLYLSL---SGVEEAIVKFAAAKGDSSLKAAM-----------ASQSVVQLGLLM
TLPMVMEIGLERGFRTALSDLIIMQLQLAPVFFTFSLGTKVHYYGRTILHGGSKYRATGR
GFVVKHEKFAENYRMYSRSHFVKGMELMVLLICYRIYGKAAEDSVGYALVMGSTWFLVGS
WLFAPFFFNPSGFEWQKIVDDWDDWNKWISSRGGIGVPANKSWESWWEEEQEHLLHS---
--------------------GFFGKFWEIFLSLRYFIYQYGIVYQLNLTK----------
ESRM-GKQH----------SIIVYGLSWLVIVAVMIVLKIVSMGRKKFSADFQLM-----
----------FRLLKLFLFIGSVVIVGMLFHFLKLTVGDIMQSLLA--------------
--FLPTGWALLQISQVARP--------------------------------------LMK
TVGMWGSVKALARGYEYIMGVVIFMPVTVLAWFPFVSEFQTRLLFNQAFSRGLQIQRILA
GGKKQK------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------
>gi|115389902|ref|XP_001212456.1|	   1899 residues, 50 /line  1,3-beta-glucan synthase component GLS2 [Aspergillus terreus NIH2624]
MSG-YPQ---------------GHYDDG----YGHQAAPHGDSYYQDD------HGQAYY
DN------HDYGDGYYDRGGYYDGGAGAYHGG-------------DAGYYDA--------
-------------------GHHDEYYGDQYYDQGGAQGY-GR----RRRGDSEEDSETFS
DFTMRSETARAADMDYYG-----RGDERYNSYADSQYGRGY--------------GYRPP
SSQISYGAN-RSS--GASTPV----YGMD----------------------YGNALPA--
GQR----SREPYPAWPSDG---------Q--VP--VSKEEIEDIFLDLVNKFGF------
----------QRDSMRNMYDHLLTQLDSRASRMTPNQALLSLHADYIGGDNANYRRWYFA
AHLDLDDAVGFANMKL-GKADRKTRKARKAAKK----KAQE-NPENVEETLEALEGDNSL
EAAEYRWKTR--MNRMSQHDRVRQVALYLLCWGEANQVRFLPECLCFIFKCADDYYNSPE
CQNRVEPV----------EE-FTYLNEVITPLYQFCRDQGYEIMDGKYVRRE-------R
DHNQIIGYDDMNQLFWYPEGI--ERIQLEDKT-RLVDI------PAA----ERWTKLKEV
NWKKAFFKTYKETRSWFHMITNFNRIWVIHLGAFWFFT--AYNA-PTLYTKDYKQQVNNK
PPGAYYWSAVGFGGALVSFIQILATLAEWLYVPR-RWAGAQHLTKRLMFLLAVF---VVN
LA--PGVVVFGFSS--SMN-KTIPLVIGIVHFFIALATFFFFAVMPLGGLF---GSYLKK
H-GR-------------QYVASQTFTASFPRLVGNDMWMSYGLWVCVFGAKLAESYFFLT
LSFKDPIRILSPMKIRQCAGVT-YIPNQLCHAQPQILLGLMFFMDLTLFFLDSYLWYIIC
NTVFSVARSFYLG-VSIWS--PWRNIFSRLPKRIYSKVL---------------------
----------------------------------------ATTDME-IK----YKPKVLI
SQVW----NAVIISMYRE------------------------------------------
-----------------------HLLAIDHVQKLLYHQVPS-EQEGKRTLRAPTFFVS--
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------QEDQ
----------------------------------SFKTEFFPPGSEAERRISFFAQSLST
PMPEPLPVDNMPTFTVLIPHYSEKILLSLREIIREDEPYSRVTLLEYLKQLHPHEWDCFV
KDTKILADETSQFNG------EYEKS---------------EKDVAKSKIDDLPFYCIGF
KSAAPEYTLRTRIWSSLRSQTLYRTVSGFMNYSRAIKLLYRVENP---EVV------QMF
G-GNS----EKLERELERMARRKFKICVSMQRYAKFNK-------EERENTEFLLRAYPD
LQIAYLDEEP-PVNE-----GEEPRLYSALIDGH-----CELLENGMRKPKFRIQLSGNP
I-LGDGKSDNQNHAIIFYRGEYIQVIDANQDNYLEECLKIRSVLAEFEELTTDNV--SPY
TPGIPS-----D-NTTPVAILGAREYIFSENVGVLGDVAAGKEQTFGTLFARTLAQ-IGG
KLHYGHPDFLNGIFMTTRGGISKAQKGLHLNEDIYAGMTALCRGGRIKHCEYFQCGKGRD
LGFGSILNFTTKIGTGMGEQMLSREYYYLGTQLPLDRFLSFYYAHPGFHINNMFIMLSVQ
MFMIVLVNLGALKHETIICRYNSDLPITDPLRPTGCANLVPIVDWVNRCVISIFIVFFIS
FVPLAVQELTERGVWRMATRLAKHFGSVSFMFEVFVCQIYANAVHQNLSFGGARYIGTGR
GFATARIPFGVLYSRFAGPSIYAGARSLMMLLFS--------TSTVWTASLIWFWVSLLA
LCISPFLFNPHQFAWNDFFIDYRDYLRWLS-RGN-SRSHASSWIGFCRLSRTRITGYKRK
LLGVPSEKGSGDVPRARITNIFFSEIIAPLVFVGVTLVPYLYINSRTGKTN--------D
NSKA-SNAIIRIAIVAFGPIGINAGVAGAFFGMACCMGPIFSMCCKKFGAVLAAIAHAIA
VIVLLAIFEVMFFLESWSWPRCVLGMIAMVAIQRFVYKLIISLALTREFKHDQSNIAWWT
GKWYS--MGWHSLSQPGRE-----------------------------------------
--FLCKITELGYFSADFVLGHLILFIMLPALCVPYMDKFHSVMLFWLRPSRQIRPPIYSL
KQ----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----SKLRKRRVIRFAILYFAM----LVLFLVLLIAPLIARNM----------------
----------NILKNFK---SF---PMDLLQPLDADNNDTTTY---------YTGAGLPA
GFVAES---SAAASTT--S
>gi|145280503|gb|AAY40291.2|	   1885 residues, 50 /line  1,3-beta-D-glucan synthase subunit [Issatchenkia orientalis]
MSS-DD-----------------HYDPN-RSQQGGQYDPAYQ------------------
----------YDQQQYNQ--QYDP-NVAAYGQE---------------GYDPNYQYQQQ-
---QPQQGGYYDEQQYGGGQYYQNQQGGGYYDQP-----------------GQHDPESYS
DFSYGPGGVPGTPYDNGN---------GNGGYG-----------------------ANYT
PSQMSYGD-PRSS--GASTPY----YGAG----------------------ANGMYDQ-G
MIA---LPTDPYPAWTADN---------E--AP--VTIEQIEDIFIDLTNKFGF------
----------QRDSMRNMFDYFMVLLDSRSSRMTPAQALLSLHADYIGGDAANYKKWYFA
CQMDIDDRVGFANIDL-GKIKNSKKKSKKSIFKRSKKNKEEQPVENSENVLQEIENDDSL
QAADYQWRAR--MNILSPMERVQDIALWLLIWGEANQVRFTPECLCFIYKCAKDYLLSDQ
CQNRLEPI----------PE-GDYLNRVITPIYRFIRDQVYEIVDGRFVKRE-------N
DHNKVVGYDDVNQLFWYPQGL--ARMHVGE-T-RLIDL------PQE----ERYFQLGEI
DWNQTFVKTYKETRSWLHVVTNFNRIWVAHISVYWMYC--AYNS-PSLYTHNYVQVLNNQ
PLASSRWASATIGGAVASGINILATLFEWMYVPR-SWAGAQHLTRRLVFLIILF---AVN
LA--PVIFVFAYAGL-TYK-STAALAVSIVFFFVAVATIVYLTVMPLGGLF---SSYMKG
N-SR-------------RYVAQQTFTASFAPLHGLDRYLSYLVWVTVFAAKFSESYYFLI
LSIRDPIRDLSTMTM-RCHGEK-WWGNKLCKQQARITLGLMYATDLILFFLDTYMWYIIV
NTIFSVGRSFYLG-ISILT--PWRNIFSRLPKRIYSKVL---------------------
----------------------------------------ATTDME-IK----YKPKVLI
SQVW----NAIVISMYRE------------------------------------------
-----------------------HLLAIDHVQKLLYHQVPS-DVEGKRTLRAPTFFVS--
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------QDDN
----------------------------------NFTTEFFPKDSEAERRISFFAQSLAT
PIPEPLPVDNMPTFTVFTPHYSEKILLSLKEIIREDDQFSRVTLLEYLKQLHPVEWDCFV
KDTKILAEETVAFED----------E---------------KEDDVKQEIDDLPFYCIGF
KSAAPEYTLRTRIWASLRSQTLYRTVSGFMNYARAIKLLYRVENP---EIV------QMF
G-GNA----EGLERELERMARRKFKFVVAMQRLAKFKK-------EELENAEFLLRAYPD
LQISYLDEEP-PLEE-----GGEPRIYSALIDGH-----CEIMSNERRRPKFRVQISGNP
I-LGDGKSDNQNHSIIFTRGEYLQLIDANQDNYLEECLKIRSVLAEFEELNVEHV--NPY
APTLSKE--PVKV-THPVAIVGAREYIFSENAGVLGDIAAGKEQTFGTLFARTLAQ-IGG
KLHYGHPDFLNSIYMLTRGGVSKAQKGLHLNEDIYAGMTAMLRGGRIKHCEYYQCGKGRD
LGFGSILNFTTKIGAGMGEQMLSREYYYLGTQLPLDRFFSFYYAHLGFHINNLFISTSLQ
MFMLTLVNINSLAHESIVCIYDKNKPITDVLYPLGCYNLAPAIDWIRRYTLSIFIVFFIS
FVPLVVQELIERGIWKMCYRFIRHISSLSPLFEVFVAQVYSTALINDVSIGGARYIATGR
GFATSRIPFSVLYSRFAEGTIYVGARCSIILLFG--------TIAHWQPALLWFWTIIVA
LMFSPFVFNPHQFAREDYFIDYRDYIRWLS-RGN-TKWHRNSWIGYVRLARSRVTGFKRK
TIGDESEKAAGDAPRAHRTTVLMSDTIPCAIYCAGLFVGYTFINAQTGVR----------
DAKM-VNATLRLIICALGPIVINCGVLFVTLGMSCCSGPLFGMCCKKTGAVMAGIAHGVA
VIVHIVFYIVMWVMEGFHFARMLLGLITMIYIQRLIFKCITLFVLTREFKNDHSNVAFWT
GKWYGSGLGLAAWSQPSRE-----------------------------------------
--FCAKIIELSHFAGDFVLGHVLLFCQLPLVLIPTIDRWHSMMLFWLKPNRQIRPPIYSL
KQ----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----ARLRKRMIKKYSVLYYTV----LVIFVALIAAPAVVGGLK---------------
--------NVNVTPTDL--PEF---ADGLFQPRHQNNNDTGFG------SGSYHPH----
WTTTTS---LVTFSTK--K
>gi|19114944|ref|NP_594032.1|	   1894 residues, 50 /line  hypothetical protein SPAC24C9.07c [Schizosaccharomyces pombe 972h-]
MSW-HEQDYGFGTSSENSKINSDEFED--------------------------SMDVTEF
NN------PGEESTYPQANSWNDS-NKTKDIAE-----------YYDYSWSGQREANQQI
PQPVPVQPRYPDEQNFS-------MNGETYPSEAYDYDYSGQEEAINAMNILQGNLERSN
EYYSEGVPYSEEDLGAYA-----GG-------------MT---------------EDDQM
Y----------SN--FNETGE----FNLD----------------------IGSSKFS--
YLN----AKNPYPAWIAEN---------S--IP--ITAENILEIFQELQAKFGF------
----------QYDSMLNMYDFFMVLLDSRSSRMDAENALKSLHADYIGGRNANYRKWYFS
SSMDIDDSVGLQNCKF-SSNGPKIKQAKKKQKRK-SNKAE-TEGTNEPETSVQI---DPL
NVSMENWENE--MKNLDCETQVRQLALYLLCWGEANNIRFCPECLCFIFKLANDFMQSED
-YAKSEPI----------EDDCFYLDNVITPLYEFIRDQQFELLDGKLVRRE-------R
DHAQIIGYDDINQLFWYPEGI--ARIVTVDGT-QLITL------PKW----ERFHKLSEV
DWKKAFYKTFYESRSWFHLVTNFNRIWVIHFTTYWYYT--VFNS-PTIIEKNFRQSVGPK
PIPSCHWTSVSLGGAVATLLMLLATIFEWIHVPR-KFPGSRPLLKRFLILILFF---ILN
VA--PTVFVFGFSTEEQQR-TTGRLTVAIVHFIFSVFTFIYFSLVPLNNLF---HRAYKS
S-SR-------------THLANRYFTADYARLQINDMCVSWGLWLLVFGAKFTESYFFLS
LSFRDPILVLSTMKP-YLCNIT-FLGSHLCIWQPKILLGIMYVTDLVLFFLDTYLWYILV
NTVFSVARSFFLG-ISIWT--PWRNIFARMPKRIYSKIL---------------------
----------------------------------------CTPEVD-SS----YKPKVLV
SQIW----NSIIISLYRE------------------------------------------
-----------------------HLLAIEHVQRLIYHQVNSLDGDGSKTLKTPTFFVS--
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------QEDS
----------------------------------SFNTEYFPAHSEAERRLSFFAQSLAT
PIPEPIPVDAMPTFTVLVPHYGEKILLSLKEIIREQDKLSRVTLLEYLKQLHANEWKCFV
RDTKILAEEDALSNQD--LNSQDESM---------------KAEQLHKKFDDLPFYCIGF
KNATPEYTLRTRIWASLRSQTLYRTVSGFMNYSRAIKLLYRVENP---DVA------QLF
E-GQM----DVLEYELDRMASRKFKMCVSMQRYAKFTA-------DEIENTEFILRAYPD
LLIAYLDEDP-PKEG-----ETTPQLYAALIDGY-----SELDENKKRKPKYRIKLSGNP
I-LGDGKSDNQNLSLPFYRGEYIQLIDANQDNYLEECLKIRSILAEFEAFDLKTN--DPY
AETNALY-----Q-NNPVAIMGAREYIFSENIGILGDVAAGKEQTFGTLFARTMAQ-IGG
KLHYGHPDFLNAIYMTTRGGVSKAQKGLHVNEDIYAGMTALQRGGRIKHCEYYQCGKGRD
LGFGSILNFTTKIGTGMGEQMVSREYYYLGTQLPFDRFLSFYYAHPGFHINNIFIMLSVQ
LFMVVLVNLGGMYHVVTVCDYDHDQKLTVPMRPEGCYQLNPVVNWLKRCIISIFIVFFIS
FVPLTVQELTERGAWRALTRLGKHFASFSPMFEVFACQTYAQSVIANLSFGGARYIGTGR
GFATARLSFSLLFSRFAGPSIYLGSRTLLMLLFG--------TMTVWIPHLIYFWISTLA
MCISPFIFNPHQFSWTDFFVDYREFIRWLS-RGN-SRSHINSWIGYCRLTRTRITGYKRR
LLGVPVSKGVIDTSRAHFTNMFFTEIFIPLMLVPLTLVSYFFIDSQPG----------NP
DPSKVTNPILRILILAFLPIIVAAVVSMTFAGMACMMGPLLDLCCKKFGAVLAALAHGIT
VFMFIIVFEVSWYLEAWCLAKTVLSMLCIIAIQRFFFKIIQVLFLTRELKHDGTNLAWWT
GKWYSRGLGFHALSQPSRE-----------------------------------------
--LICKMTELNFFAADFFLCHLLLFLMLPVLLIPFIDRWHSMMLFWLKPSKQIRPPIYSM
RQ----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----NRLRKKIVQRYGTMFFLL----LIAFLALIIIPLVVAKDL---------------
--------LANFEMDILRT-------YGLMQPRDTNWTENGTN-----------------
------------WTTV-NE
>gi|45185507|ref|NP_983223.1|	   1926 residues, 50 /line  ACL181Cp [Ashbya gossypii ATCC 10895]
MSYPNDP-------------NQHRYEPGEQGGVPHGQSPYGQQPQYDQ----------YG
NV------YDPQQAYAQDGAYYD----------Q----------TGNGYYDPQQAYDPQ-
QAY-------------D-------PEHGAYYGQP---------------RGVGPEGENFS
DFSYGPPGTPG----------------GYDSYAQ---GGG---------------VDQYT
PSRMSYGGDPRTS--GTSTPI----YG------------------------GAGFDPSAA
AMA---LPADPYPAWTADA---------Q--SP--VSVEQIEDVFIDLTNRFGF------
----------QRDSMRNVFDHFMVLLDSRASRMSPEQALLSLHADYIGGDTANYKKWYFA
AQLDLDDQVGFRNMNL-GKLSRKARKAKKKNKK----AIAE-NVADTEATLSQLEGDDSL
EAADFRWKAK--MNKLTPLERVRQIALYLLIWGEANQVRFTAECLCFLYKCASDYLDSPL
CQQRAEPL----------PE-GDYLNRVITPIYRFLRSEVYEIVDGRYMKRE-------R
DHNKVIGYDDVNQLFWYPQGI--ARIVFEDGT-RLIDL------PAE----ERYLRLGDV
AWNDVFFKTYKEVRTWLHMILNFNRIWIIHGSVYWMYT--AYNA-PTLYTAHYQQLLNNR
PVPSFPFVACSFAGTFACIVQLLATFLEWTYVPR-KWAGAQHLSRRFFFLLMIT---AIN
IA--PPVFVIAYSGDLSTY-SKLAYAISVVGFVIALITVIFFSIMPLGGLF---TSYMKN
S-TR-------------KYVASQTFTASVEPLQAMDIGLSHLLWPAVFDMKLNQSYRVLT
LLVTQHISILYIKYS-TCVCIK-YLSNRLCPHQVQVVLVLMVITDFILFFLDTYMWYIVC
NTVFSVDRSFYLG-ISILT--PWRNIFTRLPKRIYSKIL---------------------
----------------------------------------ATTDME-IK----YKPKVLI
SQVW----NAIVISMYRE------------------------------------------
-----------------------HLLAIDHVQKLLYHQVPS-EIEGKRTLRAPTFFVS--
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------QDDN
----------------------------------NFETEFFPANSEAERRISFFAQSLAT
PIPEPLPVDNMPTFTVLTPHYSERVLLSLREIIREDDQFSRVTLLEYLKQLHPVEWDCFV
KDTKILAEETAAFEG----GDEEDPE---------------KAGGLKSQIDDLPFYCIGF
KSAAPEYTLRTRIWASLRSQTLYRTVSGMMNYARAIKLLYRVENP---EIV------QMF
G-GNA----EGLERELEKMARRKFKFLVSMQRLAKFKP-------HEMENAEFLLRAYPD
LQIAYLDEEP-PLNE-----GEEPRIYSALIDGH-----CELMENGRRRPKFRIQLSGNP
I-LGDGKSDNQNHALIFYRGEYIQLVDANQDNYLEECLKIRSVLAEFEELNVEHV--NPY
TPTLKYE--EREN-NHPVAIVGAREYIFSENSGVLGDAAAGKEQTFGTLFSRTLAQ-IGG
KLHYGHPDFINATFMTTRCGISKAQKGLHLNEDIYAGMNALLRGGRIKHCEYFQCGKGRD
LGFGTILNFTTKIGAGMGEQMLSREYYYLGTQLPIDRFLSFYYAHPGFHLNNLFIQLSLQ
MFILTLMNMNALAHESLFCEYDKNKPITDALSPNGCYNLAPVVDWVRRYTLSIFIVFFIA
FVPIVVQELIERGIWKAIQRFVRHLVSLSPMFEVFAGQIYSASLVSDMTFGGARYISTGR
GFATSRIPFSILYSRFAGSAIYMGGRSMLMLLFA--------SVARWQPALLWFWACMVT
MIFSPFIFNPHQFAWQDFFLDCRGFIRWLS-RGN-NKFHKKSWIAHVQVARYRVTGFKRK
LIGDESEKSSGDSARAHRSNILFAEVLPTLVYAIGCVIAYAFINSRTGLVSRAEPPP--K
TIPI-GNPLIRLAICTLLPVVLNAGVLAGIMGLSCCAGPLLGLCCKNTGPVMAAIAHGVS
VIGHIIAILAMWVLQRMNLARMLMGFVTMIQCERVLLKLLTLIFLTREFKNDRANASFWS
GKWYSAGLGYMAWTQPARE-----------------------------------------
--YVVKIIELSEFAADFFLGHIILFCQLPVLCVPQIDKFHSIMLFWLRPSRQIRPPIYSL
KQ----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----TRLRKRMVRKYSALYFLI----LIFFVCLIAGPAVAFKQTELKHKEKDTDGNLGE
STFFNGFLNDKFGPGGM---SM---LANVLQPYQSSDATDDSS----PS-FTYDTGGHQY
FSTILPDQIHTTWSTK-AP
>gi|6321469|ref|NP_011546.1|	   1895 residues, 50 /line  Catalytic subunit of 1,3-beta-glucan synthase, involved in formation of the inner layer of the spore wall; activity positively regulated by Rho1p and negatively by Smk1p; has similarity to an alternate catalytic subunit, Fks1p (Gsc1p) [Saccharomyces cerevisiae]
MSY-NDP-------------NLNGQY----------------------YSNGDGTGDGNY
PT------YQVTQD--QS--AYDEYGQPIYTQNQ----------LDDGYYDPNEQYVDG-
TQFPQGQDPSQDQG-PY-------NNDASYYNQPPNM-----------MNPSSQDGENFS
DFSSYGPPSGTYPND------------------------------------------QYT
PSQMSYPDQDGSS--GASTPYGNGVVNGN----------------------GQYYDPNAI
EMA---LPNDPYPAWTADP---------Q--SP--LPIEQIEDIFIDLTNKFGF------
----------QRDSMRNMFDHFMTLLDSRSSRMSPEQALLSLHADYIGGDTANYKKWYFA
AQLDMDDEIGFRNMKL-GKLSRKARKAKKKNKK----AMQEASPEDTEETLNQIEGDNSL
EAADFRWKSK--MNQLSPFEMVRQIALFLLCWGEANQVRFTPECLCFIYKCASDYLDSAQ
CQQRPDPL----------PE-GDFLNRVITPLYRFIRSQVYEIVDGRYVKSE-------K
DHNKVIGYDDVNQLFWYPEGI--AKIVMEDGT-RLIDL------PAE----ERYLKLGEI
PWDDVFFKTYKETRSWLHLVTNFNRIWIMHISVYWMYC--AYNA-PTFYTHNYQQLVDNQ
PLAAYKWATAALGGTVASLIQVAATLCEWSFVPR-KWAGAQHLSRRFWFLCVIM---GIN
LG--PVIFVFAYDKD-TVY-STAAHVVGAVMFFVAVATLVFFSVMPLGGLF---TSYMKK
S-TR-------------SYVASQTFTASFAPLHGLDRWMSYLVWVTVFAAKYAESYFFLI
LSLRDPIRILSTTSM-RCTGEY-WWGNKICKVQPKIVLGLMIATDFILFFLDTYLWYIVV
NTVFSVGKSFYLG-ISILT--PWRNIFTRLPKRIYSKIL---------------------
----------------------------------------ATTDME-IK----YKPKVLI
SQIW----NAIIISMYRE------------------------------------------
-----------------------HLLAIDHVQKLLYHQVPS-EIEGKRTLRAPTFFVS--
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------QDDN
----------------------------------NFETEFFPRDSEAERRISFFAQSLST
PIPEPLPVDNMPTFTVLTPHYAERILLSLREIIREDDQFSRVTLLEYLKQLHPVEWDCFV
KDTKILAEETAAYEN-----NEDEPE---------------KEDALKSQIDDLPFYCIGF
KSAAPEYTLRTRIWASLRSQTLYRTISGFMNYSRAIKLLYRVENP---EIV------QMF
G-GNA----DGLERELEKMARRKFKFLVSMQRLAKFKP-------HELENAEFLLRAYPD
LQIAYLDEEP-PLNE-----GEEPRIYSALIDGH-----CEILENGRRRPKFRVQLSGNP
I-LGDGKSDNQNHALIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEELGIEQI--HPY
TPGLKYE--DQST-NHPVAIVGAREYIFSENSGVLGDVAAGKEQTFGTLFARTLAQ-IGG
KLHYGHPDFINATFMTTRGGVSKAQKGLHLNEDIYAGMNAVLRGGRIKHCEYYQCGKGRD
LGFGTILNFTTKIGAGMGEQMLSREYYYLGTQLPIDRFLTFYYAHPGFHLNNLFIQLSLQ
MFMLTLVNLHALAHESILCVYDRDKPITDVLYPIGCYNFHPAIDWVRRYTLSIFIVFWIA
FVPIVVQELIERGLWKATQRFFRHILSLSPMFEVFAGQIYSSALLSDIAVGGARYISTGR
GFATSRIPFSILYSRFAGSAIYMGSRSMLMLLFG--------TVAHWQAPLLWFWASLSA
LIFAPFIFNPHQFAWEDFFLDYRDYIRWLS-RGN-NKYHRNSWIGYVRMSRSRVTGFKRK
LVGDESEKSAGDASRAHRTNLIMAEIIPCAIYAAGCFIAFTFINAQTGVKT--------T
DEDR-VNSTLRIIICTLAPIVIDIGVLFFCMGLSCCSGPLLGMCCKKTGSVMAGIAHGIA
VVVHIVFFIVMWVLEGFSFVRMLIGVVTCIQCQRLIFHCMTVLLLTREFKNDHANTAFWT
GKWYSTGLGYMAWTQPTRE-----------------------------------------
--LTAKVIELSEFAADFVLGHVILIFQLPVICIPKIDKFHSIMLFWLKPSRQIRPPIYSL
KQ----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----ARLRKRMVRRYCSLYFLV----LIIFAGCIVGPAVASAHV---------------
--------PKDLGSGLT---GT---FHNLVQPRNVSNNDTGSQ------MSTYKSHY---
YTHTPS---LKTWSTI--K
>gi|68468741|ref|XP_721429.1|	   1897 residues, 50 /line  beta-1,3-glucan synthase [Candida albicans SC5314]
MSY-NDN-------------NNHYYD---------------------------PNQQGGM
PP------HQGGEGYYQQ--QYDDMGQQPHQQ-------------D--YYDPNAQYQQQ-
-PYD----------------------MDGYQDQA---NYGGQ--PMN-AQGYNADPEAFS
DFSYGGQTPGTPGYDQYG--------------------------------------TQYT
PSQMSYGGDPRSS--GASTPI----YGGQ----------------------GQGYDPTQF
NMS----SNLPYPAWSADP---------Q--AP--IKIEHIEDIFIDLTNKFGF------
----------QRDSMRNMFDYFMTLLDSRSSRMSPAQALLSLHADYIGGDNANYRKWYFS
SQQDLDDSLGFANMTL-GKIGRKARKASKKSKKA-RKAAEE-HGQDVDALANELEGDYSL
EAAEIRWKAK--MNSLTPEERVRDLALYLLIWGEANQVRFTPECLCYIYKSATDYLNSPL
CQQRQEPV----------PE-GDYLNRVITPLYRFIRSQVYEIYDGRFVKRE-------K
DHNKVIGYDDVNQLFWYPEGI--SRIIFEDGT-RLVDI------PQE----ERFLKLGEV
EWKNVFFKTYKEIRTWLHFVTNFNRIWIIHGTIYWMYT--AYNS-PTLYTKHYVQTINQQ
PLASSRWAACAIGGVLASFIQILATLFEWIFVPR-EWAGAQHLSRRMLFLVLIF---LLN
LV--PPVYTFQITKL-VIY-SKSAYAVSIVGFFIAVATLVFFAVMPLGGLF---TSYMNK
R-SR-------------RYIASQTFTANYIKLKGLDMWMSYLLWFLVFLAKLVESYFFLT
LSLRDPIRNLSTMTM-RCVGEV-WYKDIVCRNQAKIVLGLMYLVDLLLFFLDTYMWYIIC
NCIFSIGRSFYLG-ISILT--PWRNIFTRLPKRIYSKIL---------------------
----------------------------------------ATTEME-IK----YKPKVLI
SQIW----NAIVISMYRE------------------------------------------
-----------------------HLLAIDHVQKLLYHQVPS-EIEGKRTLRAPTFFVS--
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------QDDN
----------------------------------NFETEFFPRNSEAERRISFFAQSLAT
PMPEPLPVDNMPTFTVFTPHYSEKILLSLREIIREDDQFSRVTLLEYLKQLHPVEWDCFV
KDTKILAEETAAYEN----GDDSEKL---------------SEDGLKSKIDDLPFYCIGF
KSAAPEYTLRTRIWASLRSQTLYRTVSGFMNYARAIKLLYRVENP---ELV------QYF
G-GDP----EGLELALERMARRKFRFLVSMQRLSKFKD-------DEMENAEFLLRAYPD
LQIAYLDEEP-ALNE-----DEEPRVYSALIDGH-----CEMLENGRRRPKFRVQLSGNP
I-LGDGKSDNQNHAVIFHRGEYIQLIDANQDNYLEECLKIRSVLAEFEEMNVEHV--NPY
APNLKSE--DNNTKKDPVAFLGAREYIFSENSGVLGDVAAGKEQTFGTLFARTLAQ-IGG
KLHYGHPDFLNATFMLTRGGVSKAQKGLHLNEDIYAGMNAMMRGGKIKHCEYYQCGKGRD
LGFGSILNFTTKIGAGMGEQMLSREYFYLGTQLPLDRFLSFYYGHPGFHINNLFIQLSLQ
VFILVLANLNSLAHEAIMCSYNKDVPVTDVLYPFGCYNIAPAVDWIRRYTLSIFIVFFIS
FIPLVVQELIERGVWKAFQRFVRHFISMSPFFEVFVAQIYSSSVFTDLTVGGARYISTGR
GFATSRIPFSILYSRFADSSIYMGARLMLILLFG--------TVSHWQAPLLWFWASLSA
LMFSPFIFNPHQFAWEDFFLDYRDFIRWLS-RGN-TKWHRNSWIGYVRLSRSRITGFKRK
LTGDVSEKAAGDASRAHRSNVLFADFLPTLIYTAGLYVAYTFINAQTGVTSYPYEINGST
DPQP-VNSTLRLIICALAPVVIDMGCLGVCLAMACCAGPMLGLCCKKTGAVIAGVAHGVA
VIVHIIFFIVMWVTEGFNFARLMLGIATMIYVQRLLFKFLTLCFLTREFKNDKANTAFWT
GKWYNTGMGWMAFTQPSRE-----------------------------------------
--FVAKIIEMSEFAGDFVLAHIILFCQLPFLFIPLVDRWHSMMLFWLKPSRLIRPPIYSL
KQ----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----ARLRKRMVRKYCVLYFAV----LILFIVIIVAPAVASGQI---------------
--------AVDQFANIGGSGSI---ADGLFQPRNVSNNDTGNH----RPK-TYTWSYLST
RFTGST---TPYSTNPFRV
>gi|84620620|gb|ABC59463.1|	   1935 residues, 50 /line  beta-(1, 3)-D-glucan synthase [Nectria haematococca mpVI]
MSG-YPG-----------GGHHDQYD--DGYGRQPQQGGNQQGGNTDSYYQDDQYYDQGY
DN------HGRNEGYYDESGYYNADPNNPYHQ-------------DGGYYDGQDQYQDD-
-YYGNG------QG-QG-------QGQGGYYDQDYDRGYNGQ--G-G-RHGSEEDSETFS
DFTMRSDMARAAEMDYYG-----RGDENYNGYGD---GQR---------------GYRPP
SSQVSYGGN-RSS--GASTPN----YGMD----------------------YGNVLPA--
GQR----SREPYPAWTSDA---------Q--IP--LSKEEVEDIFLDLTSKFGF------
----------QRDSMRNMYDHFMILLDSRASRMTPNQALLSLHADYIGGDNANYRKWYFA
AHLDLDDAVGFANAKG-LNLKRK----GKKKKKD-AA-------ANEAETLQDLEGDDSL
EAAEYRWKTR--MNRMSQHDRVRQIALYLLCWGEANQVRFMPECLCFIFKCADDYLNSPA
CQALVEPV----------EE-FTYLNNVITPLYQYLRDQGYEILDGVYVRRE-------R
DHKNIIGYDDCNQLFWYPEGI--DRLVLQDKS-KLIDV------PPA----ERYMKLKDV
HWKKCFFKTYKESRSWFHLIVNFNRIWIIHLTMFWFYT--SHNA-PTLLVKDYEQQVNQS
PPTSKAFSIVGFGGAIASLIQLIATIAEWAYVPR-RWAGAQHLMKRFFFILLVF---ILN
VA--PGVLVFGFSSL--LK-ESILKIVGIVHFIIAIITFIFFSIMPLGGLF---GSYMST
K-TR-------------RYVASQTFTASWPVLKGNDMAMSYGLWAVVFGIKMGVSYTYLI
LSFRDPVRYLAIMNVDSCLGDNLLLKGELCKWHPTIVLALMAFTDVIFFFLDTYLWYVLL
NTLMSVARSFYIG-SSIWT--PWRNIFSRLPKRIYSKVL---------------------
----------------------------------------ATTDME-IK----YKPKVLI
SQIW----NAIVISMYRE------------------------------------------
-----------------------HLLAIDHVQKLLYHQVPS-EQEGKRTLRAPTFFVS--
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------QEDH
----------------------------------SFKTEFFPSYSEAERRISFFAQSLST
PMPEPVPVDNMPTFTVMIPHYSEKILLSLREIIREDEPYSRVTLLEYLKQLHPHEWDCFV
KDTKILADETSQYNG-----DENDKG---------------EKDTAKSKIDDLPFYCIGF
KSSAPEYTLRTRIWASLRFQTLYRTISGFMNYSRAIKLLYRVENP---EVV------QMF
G-GNT----DKLERELERMARRKFKIVVSMQRYSKFKK-------EEMENAEFLLRAYPD
LQIAYLDEEA-PTAE-----GEEPKLYSVLVDGH-----SEIMENGMRRPKFRVQLSGNP
I-LGDGKSDNQNHSIIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEEMKTDNV--SPY
TPGVKNE------VRSPVAILGAREYIFSENIGILGDIAAGKEQTFGTLFARTMAQ-IGG
KLHYGHPDFLNGVFMTTRGGVSKAQKGLHLNEDIYAGMTALLRGGRIKQCEYFQCGKGRD
LGFGSVLNFTTKIGTGMGEQFLSREYYYLGTQLPLDRFLSFYYAHPGFHLNNMFIMFSVQ
MFMITLVNLGALRHETIPCNYNRDVPITDPLFPTGCANTDALTDWIYRCVVSILFVLILS
FIPLIVQECMERGAWRAALRLTKQFSSLSLMFEVFVCQIYANSVQQNVSFGGARYIGTGR
GFATARIPFGVLYSRFAGPAIYFGARLLMMLLFA--------TLTVWKGVLIYFWLTLLA
LTISPFLYNPHQFAWNDFFIDYRDYLRWLS-RGN-SRSHASSWISYCRLSRTRITGYKRK
TLGDPSAKMSADVPRAPLANIFFSEIFSPLMLAVVTILPYLFINAQTGVVARIQPDDVKT
KIQP-TDSLIRLLIISFAPIGVNAGVLAAMFGMACCMGPVLSMCCKKFGSVLAGIAHATS
VIFLLISFLGMFVLEGFNFSRTMAGMIAATAIQRFFVKLIVSLALTREFKSDTSNIAFWT
GKWYS--MGWHSMSQPARE-----------------------------------------
--FLCKITELSMFSADFILGHWLLFFMAPVILIPKVDMLHSMMLFWLRPSRQIRPPIYSM
KQ----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----SKLRRRRVIRYAILYFTL----LIVFIALIVGPVVAGKYI---------------
--------GDTISSSLG---GL---GFNLVQPTDLKHDNTNSTSQTGTGMAGYTGAGKSK
TTGAQA---SVTAKIK-LF
>gi|125542163|gb|EAY88302.1|	   1932 residues, 50 /line  hypothetical protein OsI_009535 [Oryza sativa (indica cultivar-group)]
-MARAAA-------------N------------------WERL-VRAA------LRGERL
A-GAFGVPVTG-IAGNVPSSLGNNVHIDEVLRAADEIQDEDPTVARILCEHAYTLAQNLD
-PNSEG-------RGVL-------QFKTGLMSVIRQKLAKRE-----GGAIDRSQDVAKL
QEFYKLYREKHKVDELCEDEMKLRESAVFSGNLGELERKT-----LKRKKVLATLKVLWS
AGSST---FSRMFCYQLI---MKRVMQKDAERTEDVV--AYNII--PLDALSTTNDIVNF
PEVRAAISALQYHRELPRLPA---------TFSVPDAR--NSDMLDLLHCVFGFQFVLIV
NMLFNMIEEVQKDNVTNQREHVIHLLANEQSRLGKLPGNEP-------------------
------------------------------------------------------------
---------------------------------------------------LARELEEII
RRQTAEPAESC----ISNGG-VSFLDQVISPMYEIIAAEAANNDNGR------------A
PHSAWRNYDDFNEFFW--------------------------------------------
----------------------------------LGLMIIAFKD-RKF----DKKTVLTL
LSLGPTYVIMK-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------FIENN---HNALTILSLWAPVVSIYLLDIHVFYTVM
SAICGFLLGARDRLGEIRSVEAVHRFFEKFPEAFMDKLHVAV------------------
---------------------------------PKRKQLLSSSQHPELN----KFDASKF
APFW----NEIVRNMREE------------------------------------------
-----------------------DYINNTELDLLLMPK--N-NGSLPIVQWPLFLLAS--
------KVFLAKDIAIDCK---DSQEELWLRISKDEYMQYAVVECYHSIYYILTSIL-DK
EGRLWVERIYVGIRESISKRNIQSDLHFSRLPNVIAKLVAVAGIL-K-----ETESADLR
KGAINAIQDLYEVVHHEVLSVDMS-----------------GNIDEW--EQIKQARAE--
-----GRLFNNLK-WPTDSGLKDLIKRLYSLLTIKESAANVPKNLEARRRLEFFTNSLFM
QMPVARPVSEMLSFSVFTPYYSETVLYSKDELQKRNED--GISTLFYLQKIYP-------
------------------------------DEWKNFLARI-NRDENTTDSE---------
LFSSPNDMMELRLWASYRGQTLARTVRGMMYYRKALMLQSYLEKLQSEDIESAVA---TT
GLGLADIH-FELSPEARAQADLKFTYVVTCQIYGVQKAER----KPEAADIALLMQRNEA
LRVAYVDIVE-SVKNGKP----STEYYSKLVKAD---------IHGKDKEIYSIKLPGNF
-KLGEGKPENQNHAIIFTRGNAVQTIDMNQDNYFEEALKMRNLLEEFYQNH-G-------
------KHKP--------SILGVREHVFTGSVSSLASFMSNQETSFVTLGQRVLANPLKV
RMHYGHPDVFDRIFHITRGGISKASRVINISEDIYAGFNSTLRLGNITHHEYVQVGKGRD
VGLNQIALFEGKVAGGNGEQVLSRDIYRLGQLFDFFRMLSFYVTTIGFYFCTMLTVWTVY
IFLYGKTYLAL---SGVGESIQNRADILQNTALNAAL-----------NTQFLFQIGVFT
AIPMILGFILEFGVLTAFVSFITMQFQLCSVFFTFSLGTRTHYFGRTILHGGAKYRATGR
GFVVRHIKFAENYRLYSRSHFVKGLEVALLLVIFLAYGFNNGGAVGYILLSISSWFMAVS
WLFAPYIFNPSGFEWQKVVEDFRDWTNWLFYRGGIGVKGEESWEAWWDEELAHIH-----
--------------------NVGGRILETVLSLRFFIFQYGVVYHMDASE----------
SSK----------------ALLIYWISWAVLGGLFVLLLVFGLN-PKAMVHFQLF-----
----------LRLIKSIALLMVLAGLVVAVVFTSLSVKDVFAAILA--------------
--FVPTGWGVLSIAVAWKP--------------------------------------IVK
KLGLWKTVRSLARLYDAGTGMIIFVPIAIFSWFPFISTFQTRLLFNQAFSRGLEISLILA
GNNPNAGGLLPERPRPQPARRECRQPRGLSGHVPRHGEHVYAAGSPDRTGVRLLEHVPGQ
RQDTAIAILATLDEVGGPCRASGVFSLVKALASICEFDAAMSVIQETARGARYYNALIAV
KCKTGDFHGAREVFDEMRRSGFGPNSNSWNYLLGCLLKNGRVAEACELVEAMERSEHNDI
PNSLTYEILAYHACKAGRMDSAMRILDQMFLEKLTPRITIHTAFIKGYLYAGRIDDACRY
VSAMSTRDRRSVNRNYSLLAKLLCKAGMIVDAGRILYELMEKEAL---------------
------------LPDHS---AYIRVIKDLHKIGKGDLAAELKLILQKLS-----------
---------VHAESAG---
>gi|33391246|gb|AAQ17229.1|	   1906 residues, 50 /line  beta 1,3 glucan synthase [Lolium multiflorum]
-MARAEA-------------N------------------WERL-VRAA------LRGERM
G-GGYGVPASG-IAGNVPTSLGNNTHIDEVLRAADEIQDEDPTVARILCEHAYALAQNLD
-PNSEG-------RGVL-------QFKTGLMSVIRQKLAKRE-----GGAIDRSQDIAKL
QEFYKLYREKHKVDELCEDEMKLRESAVFSGNLGELERKT-----LKRKKVLATLKVLWS
VIEDITKEISPEDADKLISEQMKKVMQKDAARTEDVV--AYNII--PLDAVSTTNAIVTF
PEVRAAISALQYHRDLPRLPG---------TISVPDAR--NSDMLDLLHCVFGF------
----------QKGNVSNQREHIVHLLANEQSRLGKLSGNEP-------------------
-------KID------EGAVHVVFSKSLD-----------------NYM------KWCSY
LPLRPVWLSAESL---TKEKKLLYVCLYYLIWGEAGNIRFLPECLCYIFHHLAREPEETM
RKQIAYPAESC----ISNDG-VSFLDQVISPLYEITAAEAGNNDNGR------------A
AHSAWRNYDDFNEFFWSLKCF-QLGWPRKLSIP-LF--SKP---------TTKEGSLH--
RPHHYGKTSFVEHRTFLHLYHSFHRFWMFLIMMFQGLTIIAFNK-GSF----KDKTVLEL
LSLGPTYVVMKFIESVLDILMMYGAYSTSRRSAITRVIWRFCWFTMASLVICYLYIKALQ
DG----AQSAPF---------KIYVVVISAYAGFKIIVSLLMSVPCCRGVTNACYSWSFI
RLIQWMHQ-------------EHNYVGRGMHERPLDYIQYVAFWLVILAAKFSFTYFLQI
KPLVEPTQLIISFRDLQYQWHD-FFSKNN---HNAFTILSLWAPVVSIYLLDIHVFYTIM
SAIVGFLLGARERLGEIRSVEAVHRFFEKFPEAFMDKLHVPV------------------
---------------------------------PKRKQLLSSGQLPELN----KFDASRF
APFW----NEIVKNLREE------------------------------------------
-----------------------DYINNTELELLLMPK--N-KGGLPIVQWPLFLLAS--
------KVFLAKDIAVDCKDSQDSQDELWLRISKDEYMQYAVEECFHTIYHILTSIL-DK
EGHLWVQRIYGGIQESIAKKNIQSDIHFSKLPNVIAKLVAVAGIL-K-----EAESADMK
KGAVNAIQDLYEVVHHEVLSVDMS-----------------GNIDDW--SQINRARAE--
-----GRLFSNLK-WPNDPGLKDLIKRLHSLLTIKESAANVPKNLEACRRLEFFTNSLFM
RMPLARPVSEMLSFSVFTPYYSETVLYSIAELQKRNED--GISTLFYLQKIYP-------
------------------------------DEWKNFLTRI-NRDENAAESE---------
LFSSANDILELRLWASYRGQTLARTVRGMMYYRKALMLQSYLERMHSEDLESAFD---M-
-AGLADTH-FEYSPEARAQADLKFTYVVTCQIYGLQKGEG----KQEAADIALLMQRNEA
LRIAYIDVVE-SIKNGKP----STEYYSKLVKAD---------IHGKDKEIYSVKLPGNP
-KLGEGKPENQNHAVIFTRGNAVQTIDMNQDNYFEEALKMRNLLEEFSQDH-G-------
------KFKP--------SILGVREHVFTGSVSSLASFMSSQETSFVTSGQRVLSNPLKV
RMHYGHPDVFDRIFHITRGGISKASRIINISEDIFAGFNSTLRQGNITHHEYIQVGKGTD
VGLNQIALFEGKVAGGNGEQVLSRDIYRLGQLFDXFRMLSSTVTTIGFYFCTMLTVLTVY
IFLYGETYLAL---SGVGESIQNRADIMQNIALTVFL-----------NTQFLFQNGVFT
AIPMIVGLILEAGVLTAFVNFITMQFQLCSVFFTFSLGTRTHYFGRTILHGGAKYRATGR
GFVVRHIKFAENYRLYSRSHFVKGLEVALLLVIFLAYGFNDGGAIGYILLSISSWFMALS
WLFAPYVFNPSGFEWQKVVEDFRDWTNWLFYRGGFGVKGEESWEAWWDEELGHIQ-----
--------------------TFRGRILETILSLRFFIFQYGVVYHMDASE----------
PST----------------ALLVYWVSWAVLGGLFVLLMVFSLN-PKAMVHFQLL-----
----------LRLVKSIALLVVLAGLIVAIVSTRLSFTDVLASILA--------------
--YVPTGWGILSIAVAWKP--------------------------------------IVK
RLGLWKTVRSLGRLYDAGMGMIIFVPIAICSWFPFISTFQTRLLFNQAFSRGLEISLILA
GQDQNTGA----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------
>gi|4588012|gb|AAD25952.1|AF085717_1	   1899 residues, 50 /line  putative callose synthase catalytic subunit [Gossypium hirsutum]
-MSRAEE-------------L------------------WERL-VRAA------LRRERF
GMGSVGHPAGG-IAGYVPSSLN-NRDIDTILRVADEIQDEEPNVARILCEHAYSLAQNLD
-PNSEG-------RGVL-------QFKTGLMSVIKQKLAKRE-----VGTIDRSQDVARL
LEFYRLYREKNNVDKLREEEMMLRESGVFSGNLGELERKT-----LKRKRVFGTLRVLGM
VLEQLTEEI---------PAELKRVIESDAAMTEDLI--AYNIIPFPLDAPTITNAIVSF
PEVRAAVSALKHYRSLPKLPS---------DFSIPETR--SPDLMDFLHYVFGF------
----------QKDNVSNQREHVVLLLANEQSRHGIPEEPEP-------------------
-------KLD------EAAVQKVFLKSLD-----------------NYI------KWCNY
LCIQPVWSSLDAV---SKEKKVLFVSLYFLIWGEAANIRFLPECLCYIFHHMAREMDEAL
RQQIAQPANSC----SKDGV-VSFLDQVITPLYDVVAAEAANNENGR------------A
PHSAWRNYDDFNEYFWSLHCF-DLSWPWRKTS--FFQKPEPRS-------KNPL-KLG--
GGQHRGKTSFVEHRTFFHLYHSFHRLWIFLVMMFQGLTIIAFNN-GHL----NAKTLREV
LSLGPTFVVMKFTESVLDVIMMYGAYSTTRRLAVSRIFLRFIWFGVASVVVSFLYVRALQ
EESKPNSNSVVF---------RLYLIVIGIYGGIHFFISFLMRIPACHRLTELCDQFSLI
RFIKWMRQ-------------EQYYVGRGMYERTTDFIKYMIFWLIILSGKFAFAYSFQI
KPLVKPTRTVIAMDNIEYSWHD-FVSRNN---HNAVTVVCLWAPVIAMYLLDIYIFYTVL
SAVWGFLLGARDRLGEIRSLDAVQKLFEEFPDAFMKRLH---------------------
---------------------------------PVRASASSSSEVVEKS----KFDAARF
SPFW----NEIIKNLREE------------------------------------------
-----------------------DYLTNFEMELLFMPK--N-TGKLPLVQWPLFLLAS--
------KIFLAKDIAAESR---DSQDELWERISRDEYMKYAVQECYYALRYILTAIL-EA
EGRTWVERIYEGIEASITKKTISDDFQLNKLQLVISRVTALLGIL-N-----QAEKPEHE
KGAVNAVQDLYDVVRHDVLAIYLR-----------------EHSDQW--QSILKARTE--
-----GRLFAKLN-WPRDPELKAQVKRLYSLLTIKDSASNVPKNLEARRRLEFFTNSLFM
DMPPARPVQEMLSFSVFTPYYSEIVLYSMNELLKKNED--GISILFYLQKIYP-------
------------------------------DEWKNFLARI-GRDENAAETE---------
LYDSPSDILELRFWASYRGQTLARTVRGMMYYRKALMLQTYLERENARDTEAALS---R-
-LETTDTQGYELSPEARARADLKFTYVVTCQIYGRQKEEQ----KPEAADIALLMQRNEA
LRVAFIDVVE-TLKDGKV----HTEYYSKLVKAD---------INGKDKEIYAIKLPGDP
-KLGEGKPENQNHAIVFTRGNAVQTIDMNQDNYFEEALKVRNLLEEFDRDH-G-------
------IRPP--------TILGVREHVFTGSVSSLASFMSNQESSFVTLGQRVLATPLKV
RMHYGHPDVFDRVFHITRGGISKASRIINISEDIYAGFNSTLRQGNITHHEYIQVGKGRD
VGLNQIALFEGKVAGGNGEQVLSRDVYRLGQLFDFFRMMSFYFTTVGFYFCTMLTVLTIY
IFLYGRAYLAL---SGVGETMQERARIMDNAALEAAL-----------NTQFLFQIGIFS
AVPMVLGFILEQGFLRAIVSFITMQLQLCTVFFTFSLGTRTHYFGRTILHGGARYQATGR
GFVVRHIKFSENYRLYSRSHFVKGLEVVLLLVVYLAYGYN-DSALSYILLSISSWFMALS
WLFAPYLFNPSGFEWQKIVEDFRDWTNWLFYRGGIGVKGEESWEAWWDEEMAHIR-----
--------------------TMRGRIFETILSLRFFLFQYGIVYKLNVQG----------
TNT----------------SLTVYGFSWVVLAVLIILFKVFTFS-QKMSVNFQLL-----
----------LRFIQGVSFMIAIAGVAVAVALTDLSIPDIFASILA--------------
--FVPTGWGILSIAAAWKP--------------------------------------LVK
KTGLWKSVRSMARLYDAGMGMIIFVPVAFFSWFPFVSTFQTRLMFNQAFSRGLEISLILA
GNNPNTGL----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------
>gi|125570691|gb|EAZ12206.1|	   1929 residues, 50 /line  hypothetical protein OsJ_002031 [Oryza sativa (japonica cultivar-group)]
-MAASTS-------------TEVVVPAGAGAGAGAGR--WRRD-ALAH------TLGSR-
---RLPEGVAD-AGERVPDAVAPG--VMPFIRAADKVEQDSPRVAFLCRRYAYNKVQRMD
-PSSVQ-------RGVR-------QFKTYMSVKLDQILDKSS-----I---KNNYDVDNL
ASHLQPYKWEQDDTQVMGNDAK-EIQRFYKSYCAELSRISEKRNFEEVARRYQVASALYE
VLRDVT----NNKV----DSEVMKIAKVIEEKSVHFKNYKYNII--PLNFPGSSEAIVEL
HEIKGAIDALNSIDGLPMPHM---------STMHTDGNKSIRDLLDWLSLAFGF------
----------QKSNVENQRENLVLLLANIGTRTAGQDHPL--------------------
----------------VDTVNKLWKKILQ-----------------NYQ------SWCSY
LHVSSSIMNVETVTQNKQQLMLLHIGLYLLIWGEASNVRFMPECLCYIFHHMARQLHKMI
EENNFQSPPGF----E--EE-GSFLKTAIEPIYKVLQKEKLLCLQTVILILTKKRKHIRV
KVSVSFRFLPRR----SEKCFARLNWPWDLTAD-FFYQGRTTS-----------------
---TKPKTNFVEVRTFLHIFRSFNRMWMFFILAFQAMLIVSWSSSGSLSALADATVFRSV
LSVFITAALLNFIKVTLDIVLTFQAWGNMDWIQIVRYLLKFFVAIAWIIILPLAYSSSIR
YPSGAGKLLNSW------------------------------------NIMERS-NWRVI
GLIMWWIQ-------------PRLYVARGMHEDILSIIKYVFFWVVLLTCKLAFSFYVEI
SPIIGPTKFLLNQGVGNYEWHE-IFPFLP---HNLGVVITIWAPIVMVYFMDIQIWYAIF
STAFGGVSGALSHVGEIRTLGMLRARFKSMPEAFNKSHATAHREYMFH----LKCSSLHG
RMEKAHCFESLNQGSDPIDTPFTGFLTKECCGGPRGKGLGFCLGHHRHSSFPSQANLSQF
NAHWFFRHNQTVFFAKEIKLCENESVGGYNAYRGHLLGGKSPLTYCPLMWVADIWARELG
AHMSATQSQRAYSTMPFTVGLTLNFYFDRERDILMAPS--F-SSSFSVTPWPPFLVAKML
MVSGIYQVPTALHMAMTSKEGD--YHELIEKIRLDQARFNAVIECYESLVLILKNLLLDN
NDQKIVDAIDKTVLDSVENNTLLEDFHMAEIGKVSNTLAKLLHLLSN-----ESTDGTAE
RKIINALQDFMEITTRDFMK-DGQ-----------------GILKDE--NE----RKQ--
-----RFTHLDMD-MIKESFWKEKFVRLHLLLTMKDSAMDVPTNLDARRRITFFANSLFM
KMPKAPQVHDMISFSVLTPYYNEEVLYSSHELNKKNED--GISILFYLQKIYP-------
------------------------------DEWKNFLERI-GVDPENEE-----------
--AVKGYMDDVRIWASYRGQTLARTVRGMMYYRRALELQCYEDMTNAQ------------
----ADLDG-EESARSKAIADIKFTYVVSCQLYGMHKASKDSREKGLYENILNLMLTYPA
LRIAYIDEKEVPLPNGKM----EKQYYSVLVKGN-------------DEEIYRIRLPGKP
TDIGEGKPNNQNHAIIFTRGEALQAIDMNQDNYLEEAFKMRNLLEEFLIKH-G-------
------KSEP--------TILGVREHIFTGSVSSLAWFMSNQETSFVTIGQRVLANTLKV
RFHYGHPDVFDRIFHLTRGGISKASKVINLSEDIFAGFNSTLRQGNVTHHEYIQLGKGRD
VGMNQISNFEAKVANGNGEQTLCRDIYRLGHRFDFYRMLSLYFTTVGFYFNSMVYALS--
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------WLVIAIVLVSLKVVSMGREKFITNFQLV-----
----------FRILKGIVFIVLISLVVILFVVFNLTVSDVGASILA--------------
--FIPTGWFILQIAQLCGPLFRRLVTEPLCALFCSCCTGGTACKGRCCARFRLRSRDVLR
KIGPWDSIQEMARMYEYTMGILIFFPIAVLSWFPFVSEFQTRLLFNQAFSRGLQISRILT
GQNGLTS-----------------------------------------------------
----TIRCNFSWHRYGG-----SGIYLFLALVSLVTLVFLLGIM---IPQVPYNNAV---
--------------------NYGPNGYG------------------------GRDQNNKP
STPMRSHLLT-----------------------MTPKIL-------------TIGIADEH
FGAVVRRAGRNITE--------------IIQASGARIKISDRDNW---------------
------------NIRSY---SGSRVY---------DNAQGVSQFREVIK-----------
---------SREETRGIII
>gi|15221507|ref|NP_172136.1|	   1933 residues, 50 /line  ATGSL07 (GLUCAN SYNTHASE-LIKE 7); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
-MASTSS-------------G-GRGEDGRPPQMQPVRSMSRKM-TRAG------TMMIEH
----PNEDERPIDSELVPSSLAS---IAPILRVANDIDQDNARVAYLCRFHAFEKAHRMD
-PTSSG-------RGVR-------QFKTYLLHKLEEEEEIT------EHML-AKSDPREI
QLYYQTFYENNIQ------------D-------GEG-----KKTPEEMAKLYQIATVLYD
VLKTVVP---QARID----DKTLRYAKEVERKKEQYE--HYNIL--PLYALGAKTAVMEL
PEIKAAILAVCNVDNLPRPRFHSASANLDE-VDRE-RGRSFNDILEWLALVFGF------
----------QRGNVANQREHLILLLANIDVRKRDLENY---------------------
------VEIK------PSTVRKLMEKYFK-----------------NYN------SWCKY
LRCDSYLRFP--AGCDKQQLSLLYIGLYLLIWGEASNVRFMPECLCYIFHNMANEVHGIL
FGNVYPVTGDTYEAG-APDE-EAFLRNVITPIYQVLRKEVRRNKNGK------------A
SHSKWRNYDDLNEYFWDKRCF-RLKWPMNFKAD-FFIHTDEISQVPN----QRHDQVS--
HGKRKPKTNFVEARTFWNLYRSFDRMWMFLVLSLQTMIIVAWHPSGSILAIFTEDVFRNV
LTIFITSAFLNLLQATLDLVLSFGAWKSLKFSQIMRYITKFLMAAMWAIMLPITYSKSVQ
NPTGLIKFFSSWVGS-WLH-RSLYDYAIALYVLPNILAAVFFLLPPLRRIMERS-NMRIV
TLIMWWAQ-------------PKLYIGRGMHEEMFALFKYTFFWVMLLLSKLAFSYYVEI
LPLVNPTKLIWDMHVVNYEWHE-FFPNAT---HNIGVIIAIWGPIVLVYFMDTQIWYAIF
STLFGGIYGAFSHLGEIRTLGMLRSRFKVVPSAFCSKLTPLPLGHAKRKHLD--------
---------------------------------------------ETVD----EKDIARF
SQMW----NKFIHTMRDE------------------------------------------
-----------------------DLISDRERDLLLVPS--S-SGDVTVVQWPPFLLAS--
------KIPIALDMAKDFKGKE--DVDLFKKIKSEYYMHYAVVEAYETVRDIIYGLLQDE
SDKRIVREICYEVDISIQQHRFLSEFRMTGMPLLSDKLEKFLKILLS-----DYEEDDYK
SQIINVLQDIIEIITQDVMVNGH-EILERAHL---------------QSGDIESDKKEQR
FEKID------LS-LTQNISWREKVVRLLLLLTVKESAINIPQSLEARRRMTFFANSLFM
NMPDAPRVRDMLSFSVLTPYYKEDVLYSEEELNKENED--GITILFYLQRIYP-------
------------------------------EEWSNYCERV-NDL-KR---N---------
LSE-KDKAEQLRQWVSYRGQTLSRTVRGMMYYRVALELQCFQEYTEENATNGGYLPSE--
--SNEDDR-KAFSDRARALADLKFTYVVSCQVYGNQKKSSESRDRSCYNNILQLMLKYPS
LRVAYIDERE-ETVNGKS----QKVFYSVLLKG----------CDKLDEEIYRIKLPGPP
TEIGEGKPENQNHAIIFTRGEALQTIDMNQDNYFEECFKMRNVLQEFDEGRRG-------
------KRNP--------TILGLREHIFTGSVSSLAWFMSNQETSFVTIGQRVLANPLRV
RFHYGHPDIFDRIFHITRGGISKASKIINLSEDIFAGYNSTLRGGYVTHHEYIQAGKGRD
VGMNQISFFEAKVANGNGEQTLSRDVYRLGRRFDFYRMLSFYFTTVGFYFSSMITVLTVY
VFLYGRLYLVL---SGLEKNILQSASVHESNALEQAL-----------AAQSVFQLGFLM
VLPMVMEIGLEKGFRTALGDFIIMQLQLASVFFTFQLGTKAHYFGRTILHGGSKYRATGR
GFVVFHAKFAENYRLYSRSHFVKGLELVILLVVYQVYGTSYRSSSTYMYITFSMWFLVTS
WLFAPFIFNPSGFEWQKTVDDWTDWKRWMGNRGGIGIVLDKSWESWWDIEQEHLKHT---
--------------------NLRGRVLEILLALRFLLYQYGIVYHLNIAR----------
RHT----------------TFLVYGLSWAILLSVLLVLKMVSMGRRKFGTDFQVM-----
----------FRILKALLFLGFLSVMTVLFVVCGLTISDLFASILA--------------
--FLPTGWAILLIGQALRS--------------------------------------VFK
GLGFWDSVKELGRAYEYIMGLVIFTPIAVLSWFPFVSEFQTRLLFNQAFSRGLQISMILA
GKKDKET----------------------PST----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------K
>gi|30684210|ref|NP_196804.2|	   1889 residues, 50 /line  ATGSL12 (GLUCAN SYNTHASE-LIKE 12); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
-MSATRG-------------G----------PDQGPSQPQQRRIIRTQ------TA----
----GNL-GESFDSEVVPSSLVE---IAPILRVANEVESSNPRVAYLCRFYAFEKAHRLD
-PTSSG-------RGVR-------QFKTALLQRLEREHDPTL-----MGRV-KKSDAREM
QSFYQHYYKKYIQ-AL--------HN-------AAD-----KADRAQLTKAYQTANVLFE
VLKAVNLTQ-SIEVD----REILEAQDKVAEKTQLYV--PYNIL--PLDPDSANQAIMRY
PEIQAAVLALRNTRGLPWPEGH--------------KKKKDEDMLDWLQEMFGF------
----------QKDNVANQREHLILLLANVHIRQFPKPDQQP--------------KFILS
FVLIVPSQLD------DQALTEVMKKLFK-----------------NYK------KWCKY
LGRKSSLWLPT-IQQEMQQRKLLYMALYLLIWGEAANLRFMPECLCYIYHHMAFELYGML
AGNVSPMTGENVKPAYGGEE-DAFLRKVVTPIYEVIQMEAQRSKKGK------------S
KHSQWRNYDDLNEYFWSVDCF-RLGWPMRADAD-FFCLPVAV-PNTEKDGDNSKPIVA--
RDRWVGKVNFVEIRSFWHVFRSFDRMWSFYILCLQAMIIMAWDG-GQPSSVFGADVFKKV
LSVFITAAIMKLGQAVLDVILNFKAHQSMTLHVKLRYILKVFSAAAWVIILPVTYAYSWK
DPPAFARTIKSWFGS-AMHSPSLFIIAVVSYLSPNMLAETNENL------LLCC--LTDV
TIIN-TLQ-------------PRLYVGRGMHESAFSLFKYTMFWVLLIATKLAFSYYIEI
RPLVAPTQAIMKARVTNFQWHE-FFPRAK---NNIGVVIALWAPIILVYFMDSQIWYAIF
STLFGGIYGAFRRLGEIRTLGMLRSRFESLPGAFNDRLIPDGKNQQKKKGIRATLSHNF-
----------------------------------------TEDKVPVNK----EKEAARF
AQLW----NTIISSFREE------------------------------------------
-----------------------DLISDREMDLLLVPY-WA-DRDLDLIQWPPFLLAS--
------KIPIALDMAKDSNGK---DRELKKRIESDTYMKCAVRECYASFKNIIKFVVQGN
REKEVIEIIFAEVDKHIDTGDLIQEYKMSALPSLYDHFVKLIKYLVNVLPVLDNKE-EDR
DHVVILFQDMLEVVTRDIMMEDY-NISRLATFYRTAMACHSSHGGTWHGGMIPLEQQYQL
FASSG---AIRFPIEPVTEAWKEKIKRIYLLLTTKESAMDVPSNLEARRRISFFSNSLFM
DMPMAPKVRNMLSFSVLTPYYTEEVLFSLRDLETPNED--GVSILFYLQKIFPGDFCSYA
VNVAYILE--------SRL--EPDLLS--PDEWNNFLERV-KCLSEE---E---------
LKESDELEEELRLWASYRGQTLTRTVRGMMYYRKALELQAFLDMAMHEDLMEGYKAVELN
SENNSRGE-RSLWAQCQAVADMKFTYVVSCQQYGIHKRSGDPRAQ----DILRLMTRYPS
LRVAYIDEVE-EPVKDKSKKGNQKVYYSVLVKVPKSTDHSTL-AQNLDQVIYRIRLPGPA
-ILGEGKPENQNHAIIFSRGEGLQTIDMNQDNYMEEALKMRNLLQEFLTKHDG-------
------VRHP--------SILGLREHIFTGSVSSLAWFMSNQETSFVTIGQRLLANPLRV
RFHYGHPDVFDRLFHLTRGGVSKASKVINLSEDIFAGFNSTLREGNVTHHEYIQVGKGRD
VGLNQISMFEAKIANGNGEQTLSRDIYRLGHRFDFFRMMSCYFTTVGFYFSTLITVLTVY
IFLYGRLYLVL---SGLEQGLSTQKGIRDNTPLQIAL-----------ASQSFVQIGFLM
ALPMLMEIGLERGFRTALSEFVLMQLQLAPVFFTFSLGTKTHYYGRTLLHGGAKYRSTGR
GFVVFHAKFADNYRLYSRSHFVKGLEMMLLLVVYQIFGSAYRGVLAYLLITISMWFMVGT
WLFAPFLFNPSGFEWQKIVDDWTDWNKWINNIGGIGVPAEKSWESWWEEEQEHLRYS---
--------------------GKRG--LWSIMAGDFL----------DIVC----------
DED---------------------------------CFGWKAEIQREFSADVP-------
------------------------------------------------------------
---------------------------------------------------------VDK
GADIHDVYRNYCDIDHTGSH----------------DDTRHNCVYPCLYAHRLGDALDCA
S-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------V
>gi|42566048|ref|NP_191469.2|	   1934 residues, 50 /line  ATGSL11 (GLUCAN SYNTHASE-LIKE 11); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
-MEASSS-------------G----------TAELPRSLSRRAPSRAT------TMMIDR
----PNEDASAMDSELVPSSLAS---IAPILRVANEIEKDNPRVAYLCRFHAFEKAHRMD
-ATSSG-------RGVR-------QFKTYLLHRLEKEEEET------KPQL-AKNDPREI
QAYYQNFYEKYIK------------E-------GET-----SRKPEEMARLYQIASVLYD
VLKTVVP---SPKVD----YETRRYAEEVERKRDRYE--HYNIL--PLYAVGTKPAIVEL
PEVKAAFSAVRNVRNLPRRRIHL-PSNTPNEMRKA--RTKLNDILEWLASEFGF------
----------QRGNVANQREHIILLLANADIRKRNDEEY---------------------
------DELK------PSTVTELMDKTFK-----------------SYY------SWCKY
LHSTSNLKFP--DDCDKQQLQLIYISLYLLIWGEASNVRFMPECICYIFHNMANDVYGIL
FSNVEAVSGETYETEEVIDE-ESFLRTVITPIYQVIRNEAKRNKGGT------------A
SHSQWRNYDDLNEYFWSKKCF-KIGWPLDLKAD-FFLNSDEIT-PQD----ERLNQVT--
YGKSKPKTNFVEVRTFWNLFRDFDRMWIFLVMAFQAMVIVGWHGSGSLGDIFDKDVFKTV
LTIFITSAYLTLLQAALDIILNFNAWKNFKFSQILRYLLKFAVAFMWAVLLPIAYSKSVQ
RPTGVVKFFSTWTGD-WKD-QSFYTYAVSFYVLPNILAALLFLVPPFRRAMECS-DMRPI
KVIMWWAQASIKLFFWFLSILPKLYVGRGMHEDMFSLFKYTTFWIMLLISKLAFNYYVEI
LPLITPTKMIMNLHIGHYQWHE-FFPHAT---NNIGVVIAIWAPIVLVYLMDTQIWYAIF
STLFGGIHGAFSHLGEIRTLGMLRSRFESIPIAFSRTLMPSEDAK--RKHAD--------
---------------------------------------------DYVD----QKNITNF
SQVW----NEFIYSMRSE------------------------------------------
-----------------------DKISDRDRDLLLVPS--S-SGDVSVIQWPPFLLAS--
------KIPIAVDMAKDFKGKE--DAELFRKIKSDSYMYYAVIESYETLKKIIYALLEDE
ADRRVMNQVFLEVDMSMQQQRFIYEFRMSGLPLLSDKLEKFLSILLS---DY-EDQGTYK
SQLINVFQDVIEIITQDLLVNGH-EILERARV---------------HSPDIKNEKKEQR
FEKIN------IH-LVRDRCWREKVIRLHLLLSVKESAINVPQNLEARRRITFFANSLFM
NMPSAPRIRDMLSFSVLTPYYKEDVLYSEEDLNKENED--GISILFYLQKIYP-------
------------------------------DEWTNYLDRL-KDP------K---------
LPE-KDKSEFLREWVSYRGQTLARTVRGMMYYRQALELQCYQEVAGEQAEFSVFRAMA--
--SNDENQ-KAFLERARALADLKFTYVVSCQVYGNQKKSGDIHNRSCYTNILQLMLKYPS
LRVAYVDERE-ETADAKS----PKVFYSVLLKG----------GDKFDEEIYRIKLPGPP
AEIGEGKPENQNHAIIFTRGEALQTIDMNQDNYFEEAFKLRNVLEEFNKERVG-------
------RRKP--------TILGLREHIFTGSVSSLAWFMSNQESSFVTIGQRILANPLRV
RFHYGHPDIFDRIFHITRGGVSKASKVINLSEDIFGGFNSTLRGGYVTHHEYIQVGKGRD
VGLNPISIFEAKVANGNGEQTLSRDVYRLGHRFDFYRMLSFYFTTIGFYFSSMLTVLTVY
AFLYGRMYMVM---SGLEKEILRLASPNQLEALEQAL-----------ATQSIFQLGFLM
VLPMVMEIGLEHGFRSAIVDFFIMQLQLASVFFTFQLGTKSHYYGRTILHGGSKYRPTGR
GFVVFHAKFAENYRLYSRSHFVKGLELLLLLVVYQIYGHSYRSSNLYLYITVSMWFMVGS
WLFAPFIFNPSGFEWQKTVDDWTDWKRWLGDRGGIGIPVEKSWESWWNVEQEHLKHT---
--------------------SIRGRILEITLALRFFIYQYGIVYQLNISQ----------
RSK----------------SFLVYGLSWVVLLTSLLVLKMVSMGRRRFGTDFQLM-----
----------FRILKALLFLGFLSVMTILFVVFKLTLTDLSASVLA--------------
--FLPTGWAILLIGQVLRS--------------------------------------PIK
ALGVWDSVKELGRAYENIMGLVIFAPIAVLSWFPIVSEFQARLLFNQAFSRGLQISMILA
GRKDKAT----------------------SSH----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------K
>gi|92881946|gb|ABE86482.1|	   1908 residues, 50 /line  Glycosyl transferase, family 48 [Medicago truncatula]
-MASTSG-------------T--------KGPFEISRQPSKRM-IRAP------TRTVEL
----PNEE-NIMDSEIVPSSLAV---LVPILRAAIEIEGENPRVAYLCRFHAFEKAHTMD
-PTSSG-------RGVR-------QFKTYLLHKLEKEGELT------EKHT-KRSDAKEL
QNYYQYFYEKRIR------------D-------GEF-----TKKPEEMVRNVQIATVLYE
VLKTLLT---PQTIE----EKTKRYAADVENKRGQYE--HYNIL--PLYAVGVKPVIMDL
PEIKAAIAALSKVDNLPMPIIHSRPDNDDSTMPME-RVKNVNDILDWIASIFGF------
----------QKGNVANQREHLILLLANIDIRNRPAS-----------------------
------NEIR------EETIEKLMATTFK-----------------NYE------SWCHY
VRCKSNIRYS--DGQDRQQLELIYIALYLLIWGEASNIRFMPKCLCYIFHHMCNDVFGIL
YSNTYQVSGDAYQI-VTRDD-EHFLREVITPLYENLMKEAKRSNKGK------------A
SHSNWRNYDDLNEYFWSDKCF-KLGWPMNLNSD-FFRHKDETQ-TAN----QGRGRTTTV
PGKKKPKTNFVEVRTYLHLYRSFDRMWIFFILALQAMIIISWSNLGLVGVLTDEDVFKNV
SSIFITYAILNFFQVTIDIILIWNALRNMKFTQLLRYFLKFVVAAIWVVVLPVCFSSSLQ
NPTGLIQFVTNWAGD-WGP-QSIYYWAVAIYMIPNIVAALLFFLPPIRRTLERS-NMRIV
TLLMWWAQ-------------PKLYVGRGMHESVFSLVKYTLFWVMLLISKLAFSYYVEI
SPLIEPTKLIMAMHIDNYQWHE-VFPEND--MHNLSVVISIWAPIILVYFMDTQIWYAIY
ATLFGGIIGAFSHLGEIRTLGMLRSRFQSVPKAFSESFWTGRNRKNIQEESD--------
---------------------------------------------DAYE----RDNIAYF
SQVW----NEFINSMREE------------------------------------------
-----------------------DLISNRDRDLLLVPY--S-SIDVSVIQWPPFLLAS--
------KIPIAVDMAKDYKKDD--DAELFKKIKSDGYMYSAVVECYETLKDIILSLLLSA
EDRHFIELICAKVEECIEDEVFVKEFKMSGLPSLSEKLEKFLTLLRS-------EDSKPE
SQIVNVLQDIVEIIIQDVMVDGH-VILQTPQ---------------------HNVDKQQR
FVNID------TS-FTQKRSVMEKVIRLHLLLTVKESAINVPQNIEARRRITFFANSLFM
NMPKAPKVRDMLSFSVLTPYYKENVQYSNDELKKENED--GISILFYLTKIYP-------
------------------------------DEWANFDERI-KSENFE-------------
----EDREEYVRQWASYRGQTLSRTVRGMMYYWQALLLQYLIENAGDSGISEGPRSFD--
--YNERDK-R--LEQAKALADLKFTYVVSCQLYGSQKKSKNTFDRSCYNNILNLMVTHSA
LRVAYIDETE-DTKGGK------KVYYSVLVKG----------GEKYDQEIYRIKLPGPP
TEIGEGKPENQNHAIIFTRGEALQTIDMNQDNYYEEAFKMRNVLEEFHAHK-G-------
------QRKP--------TILGLREHIFTGSVSSLAWFMSNQETSFVTIGQRVLANPLKV
RFHYGHPDIFDRIFHITRGGISKASKTINLSEDIFAGYNSTLRQGYITHHEYIQVGKGRD
VGLNQISLFEAKVANGNGEQTLCRDVYRLGRRFDFFRMLSFYFTTVGFYFSSMITVLTVY
VFLYGRLYMVL---SGVEREIISSSNIHQSKALEQAL-----------ASQSVVQLGLLL
VLPMVMEIGLEKGFRTALGDFIIMQLQLASVFFTFQLGTKAHYYGRTLLHGGSKYRPTGR
GFVVFHAKFADNYRMYSRSHFVKGLEILILLIIYEVYGESYRSSTLYFFITISMWFLAIS
WLFAPFLFNPSGFDWQKTVDDWSDWKRWMGNRGGIGIPSDKSWESWWDEENEHLKYS---
--------------------NVRGKILEIVLACRFFIYQYGIVYHLNIAR----------
RSK----------------NILVFALSWVVLVIVLIVLKMVSMGRRRFGTDFQLM-----
----------FRILKALLFLGFLSVMAVLFVVCALTVSDLFASVLA--------------
--FMPSGWAIILIAQTCRG--------------------------------------LLK
WAKLWASVRELSRAYEYVMGLIIFMPTAVLSWFPFVSEFQTRLLFNQAFSRGLQISMILA
GKKDTYK----------------------TE-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------
>gi|50547719|ref|XP_501329.1|	   1914 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
-MPRRAT-------------MRSVY-------------------SEST------HSMASY
DN----RSSDFSEDYTTEGHITE---NAATDGHYTTTDDD----SYDSYYDGGDNASTMR
-MAPDT-------SSLA-------AVNSSVDWIREKDEAIV-------NPGVAPDLQGDG
NLHSIPPDHQKYEHGAP------------------------AFTTGKMSAPYNQKSAPYD
GQEMSGFVSPQVR------YRMALFPEEI----------------------GSGNVPLEY
TDEHQKHLFETYFDWVPHP---------QIVIP--INLYEVVEVFDLLQSKFGF------
----------QVQSMRNMRDHFMCLLDSRSSRMSYNDALLTLHADYIGGEHSNYRKWYFA
SQMDITDKIGGINVDYSGKLTKAGRRMVA-----------------TDTVWNEENANFSY
EHSNRNWKNH--MATISPKDQLKDIALYLLIWGEANQVRFMPECLCFLYNCARDFCYSTA
FAT-APDV----------ED-GVFLDTIITPLYSFYRNQRYENFEGKFIDRE-------R
DHKDVIGYDDINQLFWYRQGL--LRIKLKGGTNRILDL------PAS----ERYNALSTV
DWTTCFYKTYHESRSWMHLAVNFHRIWIIHFCVFWFYT--AFNT-PSLYTENYSQELDNL
PPAHVRISVVGLGGVMAPLICLVAVMGEAVFVPM-RWPGRERVAYRLFCLLLVT---SLN
AA--PAVFVLLWYSR-TEE-NGQALMISIIQLVIAFVTVLYFAFTPLKSLF---TFFPKD
KFNR-------------RQLPTKFFASSFPPLKGNDRWMSYGLWVCVFVAKYIESYFFMI
LSLKDPTRELGLVEYDKCVGAE-YVGKILCKYQPLFVLACMFVTELVLFFLDTYLWYIIF
NTTFSVIRSVYLG-GTLWT--PWRNTFSRLPKRIYSKIL---------------------
----------------------------------------STSHLPSNR----YKKSYLV
SQVW----NSIITSLYRE------------------------------------------
-----------------------HIISQEHAHRLAYQQ-EI-DGQGMCVLSEPKYFAS--
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------QEDQ
----------------------------------SFHNSVFDSQTEGERRLSFFAQSLAT
PIPDNYVIDEMPTFTVLVPHYNEKILLSLKEIIKEDGENSRVTLLEYLKQLHANEWDNFV
CDSKLMHDFMHNNGGEEVQGSYQEKKDGGEDGLLNVPEVIHKRDQKSGKYDNLPYYCVGF
KFSSPENQMRTRIWASLRCQTLYRTVCGFMNYSRAIKLLYNVENP---ELL------HHC
Q-NDT----RVFNQHLDMISRRKFRLLVSMQRLSKFD-------VQETENLEYLLKMHPE
LQVAYLDEDP--SQG-----GREPIVYASLIDGD-----SDILDNGRRKPRYRIRLSGNP
I-LGDGKSDNQNVALIFHRGEYIQLVDANQDSYIEECLKIRSILAEFEEFPAGNVPASPY
ASPKANEKNPDTL-ANPVAFIGSREYIFSENIGVLGDIAAGKEQTFGTLFARTLSK-IGG
KLHYGHPDYLNATFMVTRGGVSKAQKGLHLNEDIYAGMNALMRGGRIKHSEYVQCGKGRD
LGFGSILNFSTKIGAGMGEQMLSREYYYLGTHLPLDRFLSFYYAHPGFHINNMFIIMSVE
FFLIVGINIAALYSSSVICEYDRSAPITAARVPEGCTNVIPIIEWLERCILSIFVVFFMS
FVPLFIQEFSERGFLRAATRLAKHLACLSPLFEVFCCQIYAKALLQDLTIGGARYISTGR
GFATSRIPFVTLYSRFATASIYFGAISLLIMIVI--------STTMWRVALLWFWVTAVA
LCISPFLFNPHQFAWVDYFVDYRNFIRWLN-RGN-TKWHKSSWIGYTRLIRTRITGYKKK
TLNEISETDSRGVMKPSLVNVFLSEVVGTLLSACCITLPYLFMNYQNEQI----------
DGTP-SNPLMRLAICTLFPIVMNIVMELVLFGVSCLVGPIFSVCCKSAPGTFAAVVHTFA
VLNHLVAFELMWFFQRWNVPVTLLGFISCTLIQDFIFKTIITLFLSRELKHDHTNRAWWS
GKWFTAGLGWRILTQPWRE-----------------------------------------
--MLCKKIESSMYALDYILGHALFFVQFPLILIPFVDRWHSMMLFWLRPSRQIRSPVFST
RQ----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----KRVRRRIVTRYAILFALN----LLAMTALFVLPIVFKDTL---------------
--------DIELDNHVP---WF---LRGLQQPLPNARLPLGKLPEKKID-----------
------------------V

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.