Fandom

Proteins Wiki

At2g13680.1/FASTA

< At2g13680.1

47,922pages on
this wiki
Add New Page
Talk0 Share

MAQSSTSHDSGPQGLMRRPSRSAATTVSIEVFDHEVVPASLGTIAPILRVAAEIEHERPRVAYLCRFYAF EKAHRLDPSSGGRGVRQFKTLLFQRLERDNASSLASRVKKTDGREVESFYQQYYEHYVRALDQGDQADRA QLGKAYQTAGVLFEVLMAVNKSEKVEAVAPEIIAAARDVQEKNEIYAPYNILPLDSAGASQSVMQLEEVK AAVAALGNTRGLNWPSGFEQHRKKTGNLDLLDWLRAMFGFQRDNVRNQREHLVCLFADNHIRLTPKPEPL NKLDDRAVDTVMSKLFKNYKNWCKFLGRKHSLRLPQAAQDIQQRKILYMGLYLLIWGEAANIRFMPECLC YIFHNMAYELHGLLAGNVSIVTGENIKPSYGGDDEAFLRKVITPIYRVVQTEANKNANGKAAHSDWSNYD DLNEYFWTPDCFSLGWPMRDDGDLFKSTRDTTQGKKGSFRKAGRTGKSNFTETRTFWHIYHSFDRLWTFY LLALQAMIILAFERVELREILRKDVLYALSSIFITAAFLRFLQSVLDVILNFPGFHRWKFTDVLRNILKI VVSLAWCVVLPLCYAQSVSFAPGKLKQWLSFLPQVKGVPPLYIMAVALYLLPNVLAAIMFIFPMLRRWIE NSDWHIFRLLLWWSQPRIYVGRGMHESQIALIKYTIFWLLLFCCKFAFSYFLQVKLLVKPTNAIMSIRHV KYKWHEFFPNAEHNYGAVVSLWLPVILVYFMDTQIWYAIFSTICGGVIGAFDRLGEIRTLGMLRSRFQSL PGAFNTYLVPSDKTRRRGFSLSKRFAEVTAARRTEAAKFSQLWNEIISSFREEDLISDREMDLLLVPYTS DPSLKLIQWPPFLLASKIPIALDMAAQFRTRDSDLWKRICADEYMKCAVIECYESFKHVLHTLVIGENEK RIIGIIIKEVESNISKNSFLSNFRMAPLPALCSKFVELVGILKNADPAKRDTVVLLLQDMLEVVTRDMMQ NENRELVELGHTNKESGRQLFAGTDAKPAILFPPVATAQWHEQISRLHLLLTVKESAMDVPTNLEAQRRI AFFTNSLFMDMPRAPRVRNMLSFSVLTPYYSEETVYSKNDLEMENEDGVSVVYYLQKIFPDEWTNFLERL DCKDETSVLESEENILQLRHWVSLRGQTLFRTVRGMMYYRRALKLQAFLDMANETEILAGYKAISEPTEE DKKSQRSLYTQLEAVADLKFTYVATCQNYGNQKRSGDRRATDILNLMVNNPSLRVAYIDEVEEREGGKVQ KVFYSVLIKAVDNLDQEIYRIKLPGPAKIGEGKPENQNHALIFTRGEALQAIDMNQDHYLEEALKMRNLL EEFNEDHGVRAPTILGFREHIFTGSVSSLAWFMSNQETSFVTIGQRVLASPLKVRFHYGHPDVFDRIFHI TRGGISKASRGINLSEDIFAGFNSTLRRGNVTHHEYIQVGKGRDVGLNQISLFEAKVACGNGEQTLSRDL YRLGHRFDFFRMMSCYFTTVGFYISSMIVVLTVYAFLYGRLYLSLSGVEEAIVKFAAAKGDSSLKAAMAS QSVVQLGLLMTLPMVMEIGLERGFRTALSDLIIMQLQLAPVFFTFSLGTKVHYYGRTILHGGSKYRATGR GFVVKHEKFAENYRMYSRSHFVKGMELMVLLICYRIYGKAAEDSVGYALVMGSTWFLVGSWLFAPFFFNP SGFEWQKIVDDWDDWNKWISSRGGIGVPANKSWESWWEEEQEHLLHSGFFGKFWEIFLSLRYFIYQYGIV YQLNLTKESRMGKQHSIIVYGLSWLVIVAVMIVLKIVSMGRKKFSADFQLMFRLLKLFLFIGSVVIVGML FHFLKLTVGDIMQSLLAFLPTGWALLQISQVARPLMKTVGMWGSVKALARGYEYIMGVVIFMPVTVLAWF PFVSEFQTRLLFNQAFSRGLQIQRILAGGKKQK

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.