Fandom

Proteins Wiki

At2g13440.1/MSA

< At2g13440.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|15225046|ref|NP_178974.1|	   723 residues, 50 /line  glucose-inhibited division family A protein [Arabidopsis thaliana]
----MRAA----AAATATVSLRHFRSFPTIVPSLLFSSSSSIPFHSP--------RLCVF
LRPRQLFLNRPLAASFSS--SSSGATSDSTYDVIVVGAGHAGCEAALASARLGASTLLLT
LNLDRIAWQPCNPAVGGPAKSQLVHEVDALGGDIGKVADRCYLQKRILNVSRGPAVRSLR
AQTDKREYATEMKKIVDST--------ENLCIREAMVTDIIVGKN---------------
-DNVEGVATFFGMNFYAPSVILTTGTFMSGKIWVGKKSMPAGRAGESASQGLTENLQKLG
FETDRLKTGTPARVDRRTIDFSNLEAQHGDEEVSWFSFD-P--DFHIEREQMCCYLTRTT
KITHQLIRDNLHETPTYGGWVEAKGPRYCPSIEDKIVRFKDKESHQIFLEPEGRDVPEIY
VQGFSTGLPENLQLPLLRSLPGLENCSMLRPAYAVEYDYLPAHQCSRSLMTKKIEGLFFS
GQINGTTGYEEAAAQGIISGINAARHAD-----GKKHVVLERESSYIGTLIDDLVTKDLR
EPYRMLTSRSEHRLLLRFDNADSRLTPLGRELGLIDDRRWKLYQEKQARISEEKKRLKTV
KISVAVG-DLAAEVSSVSSQPVKESATLESLLKKPHIHYKLLEKH---GFGNET----LS
R-MEKDCVEIDIKYEGFIVRQQNQLQQMVHQQHRRLPDDLDYYSMTTLSHEGREKLSKVR
PETIGQASRVGGVSPADITALLITLESNRRRTQDVKRGKILEHALAESNPQWVE-DRE-H
VVNE
>gi|102139963|gb|ABF70103.1|	   730 residues, 50 /line  glucose-inhibited division A family protein [Musa balbisiana]
MLLRFRPM----AATATTVVLPRLSS----RLSPLSCTSRTLLFPSP--VRRPLRRQSLL
LRRWNSSHRRGLTTLAQGG-KDNSKAIEEQYDVIVVGGGHAGCEAALAAARLGARTLLLT
LNIDRIAWQPCNPAVGGPAKSQLVHEVDALGGEIGKIADRCYLQKRVLNRSKGPAVRALR
AQTDKREYALEMKKVVEST--------TNLFIREAMVTNILVGKN---------------
-DTVEGVSTFFGMNFYAPSVVLTTGTFMSGKIWVGRTSMAAGRAGESASHGLTESLQQLG
FETDRLKTGTPARVDYRSVNFSGLEPQHGDEEVNWFSFD-P--DYHVEREQMCCYLTRTT
KDTHQLIKDNLHETPTYGGWVEAKGPRYCPSIEDKIVRFQDKDSHQIFLEPEGRTVPELY
VQGFSTGLPERLQLTLLRTLPGLENCLMLRPAYAVEYDYLPAHQCSRSLMTKKIEGLFFS
GQINGTTGYEEAAAQGLVSGINAARHSD-----GKSIIILERESSYIGTLIDDLVTKDLR
EPYRMLTSRSEHRLLLRADNADSRLTPLGWDIGLIDERRWNLYQLKQTRILEEKERLKSV
RISG-GD--FAAEVSHLSGQPVKDSSSLESILKKPHVEYKVLDKH---GYGNEL----LS
R-IEKECVEIDIKYAGFIARQRSQLQQIVNQQHKRLPEDLDYYSMTTLSLEAREKLSKVR
PQTIGQASRVGGVSPADMTALLICLEAKRRMASEMKRHGLVRSAADDLDETESCLATARR
AAGA
>gi|113476427|ref|YP_722488.1|	   637 residues, 50 /line  glucose inhibited division protein A [Trichodesmium erythraeum IMS101]
------------------------------------------------------------
--------------------MNQTFDFQDEYDIIVVGAGHSGCEAALATARLGCHTLLLT
LNLDKIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRILNSSRGPAVWALR
AQTDKREYATIMRNIVENQ--------ENLRVRESMVTDLVLGDN---------------
-EEIIGVETYFGVAFKCKAVILTTGTFLGGVIWVGNKSMPAGRAGEFSAIGLSETLNKLG
FETGRLKTGTPARVDKRSVDYTDLEAQPGDEKVRWFTFD-P--EVWVEREQMCCYLTRTT
PETHKLIRDNLHLSPVYGGWVDAKGPRYCPSIEDKIVRFADKHSHQIFIEPEGRDIPELY
IQGFSTGLPEKLQLQMLQSLPGLENCLMLRPAYAVEYDYLPATQCYPTLMTKKIEGLFCA
GQINGTTGYEEAAAQGLVAGINAVKFVK-----NEEMIIFPREQSYIGTLIDDLCTKDLR
EPYRMLTSRSEYRLILRSDNADQRLTPLGREIGLIDDRRWELFESKQANINSEKSRLNST
RIKE-LD-EVAINIVADTHTKIKGSITLADLLRRPGFHYVDLEKY---NLGNLD----LK
L-VEKEGAEIDIKYSGYLQRQQNQIDQISRQKNRRLPTNLDYLSISTLSLEAREKLSKVQ
PLTIGQASRIGGVNPADINALLVYLEVQYRQFQLTSAN----------------------
---V
>gi|119489483|ref|ZP_01622244.1|	   638 residues, 50 /line  glucose-inhibited division protein A [Lyngbya sp. PCC 8106]
------------------------------------------------------------
------------------MTQTSPVDFQDEFDIVVVGGGHSGCEAALASARLGCRTLMLT
LNLDKIAWQPCNPAVGAPAKSQLTHEVDALGGEIGKMADRTYLQKRLLNNSRGPAVWALR
AQTDKREYAAVMQNIIENQ--------ENLAIREGMVTDVVLGEN---------------
-DEIIGVKTYFDVAFKCKAVILTTGTFLGGVIWVGNKSMSAGRAGEFAAVGLTDTLNKLG
FETGRLKTGTPARVDKRSVNYSQLEPQPGDEEVRWFSFD-P--EVWVEREQMCCYLTRTT
AETHRIIRENLHLSPVYGGWVEAKGPRYCPSIEDKIVRFADKESHQIFIEPEGRNIPELY
IQGFSTGLPERLQLQMLRSLPGLEKCTMLRPAYAVEYDYLPATQCYPTLMTKRIEGLFCA
GQINGTTGYEEAAAQGIVAGINAARFSR-----NQEMIIFPREGSYLGTLIDDLCTKDLR
EPYRMLTSRSEYRLLLRSDNADQRLTPLGREIGLIDDRRWQLFEHKQANIIAEKERLHST
RIKE-RD-EVGMAIVSDTQQKIKGSITLADLLRRPGFHYVNLERY---NLGNPD----ID
S-VEKEGAEIEVKYSGYLQRQQNQIDQISRHANRKLPENINYMMIETLSMESREKLTKVR
PLTIGQASRIGGVNPADVNALLIYLEIQNRQQTLTVG-----------------------
---N
>gi|119510372|ref|ZP_01629507.1|	   638 residues, 50 /line  glucose-inhibited division protein A [Nodularia spumigena CCY9414]
------------------------------------------------------------
--------------------MHNSVEFQDAFDVIVVGAGHSGCEAALAAARLGCRTLLLT
LNLDKIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKVADRTYLQKRILNSSRGPAVWALR
AQSDKREYAAVMKTIVENQ--------ENLSIREAMATDLVLGAN---------------
-DEVIGVETYFGVAFGCKAVILTTGTFLGGKIWVGNKSMPAGRAGEFAAEGLTQTLNRLG
FETGRLKTGTPARVDKRSVDYSKMTIQPGDEEVRWFSFD-P--DVWIKKEQIPCYITRTT
AETHRLIRDNLHLSPVYGGWVEAKGPRYCPSIEDKIVRFADKQSHQIFIEPEGRDIPELY
IQGFSTGLPETLQLQMLRSLPGLENCTMLRPAYAVEYDYLPATQCYPTLMTKKISGLFCA
GQINGTTGYEEAAAQGIVAGINAARLVR-----GEEMIVFPREHSYLGTLVDDLCTKDLR
EPYRMLTSRSEYRLLLRSDNADQRLTPLGREIGLIDDRRWNLFTDKQTQITTEKARLYAT
RIKE-HD-EIGQAIASVSQQTIKGSITLAELLRRPGFHYVDLDSY---GLGNPN----LK
Q-AEKEGAEIDIKYSGYLARQQNQIEQIARQAHRQLPADLDYTTIDTLSKEAREKLSKVK
PLTLGQASRTGGVNPADINALLIYLELRKTNSQSELKAL---------------------
---A
>gi|17231053|ref|NP_487601.1|	   640 residues, 50 /line  glucose-inhibited division protein A [Nostoc sp. PCC 7120]
------------------------------------------------------------
------------------MTMHNSVEFQDAFDVIVVGAGHSGCEAALATARLGCRTLLLT
LNLDKIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRILNSSRGPAVWALR
AQTDKREYAAIMKNIVENQ--------ENLSIRESMVTDLVLGAN---------------
-DEVIGVETYFGVAFQCKAVILTTGTFLGGKIWVGNKSMPAGRAGEFAAEGLTETLNRLG
FETGRLKTGTPARVDKRSVDYSKMQLQPGDAEVRWFSFD-P--DVWVEREQLPCHMTRTT
PETHRLIRENLHLSPVYGGWVEAKGPRYCPSIEDKIVRFVDKESHQIFIEPEGRDIPELY
IQGFSTGLPENLQLQMLRSLPGLENCVMLRPAYAVEYDYLPATQCYPTLMTKKIAGLFCA
GQVNGTTGYEEAAAQGIVAGINAARFVR-----DEEMIVFPREHSYLGTLVDDLCTKDLR
EPYRMLTSRSEYRLLLRSDNADQRLTPLGREIGLIDDRRWQMFTRKQEQITGEKERLYAT
RVKE-ND-DVGKAIASNTQQAIKGSITLADLLRRPGFHYVDLDRY---GLGNPE----LT
P-AEKEGAEIDIKYSGYLARQQSQIEQIARQAQRQLPGDLDYTTVDTLSKEAREKLNKVK
PLTIGQAARIGGVNPADINALLIYLELRQSKHQKGLAVL---------------------
---P
>gi|53687210|ref|ZP_00345191.1|	   670 residues, 50 /line  COG0445: NAD/FAD-utilizing enzyme apparently involved in cell division [Nostoc punctiforme PCC 73102]
MITFLLESYI-------------------------HETTGTAKIEK--------------
--------NSKLADP-VSMTMHNSVEFQDAFDVIVVGAGHSGCEAALASARLGCRTLLLT
LNLDRIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKVADRTYLQKRILNSSRGPAVWALR
AQTDKREYAAVMKNIVENQ--------ENLTIRESMVTDLVLGAN---------------
-DEVIGVETYFGVGFRCKAVILTTGTFLGGKIWVGNKSMPAGRAGEFAAEGLTQTLNRLG
FETGRLKTGTPARVDKRSVDYSKMLIQPGDEDVRWFSFD-P--EAWVEREQMPCYITRTT
TETHRLIQDNLHLSPVYGGWVEAKGPRYCPSIEDKIVRFADKESHQIFIEPEGRDIPELY
IQGFSTGLPENLQLQMLRTLPGLEKCVMLRPAYAVEYDYLPATQCYPTLMTKKVAGLFCA
GQINGTTGYEEAAAQGLVAGINAARFVH-----SQEMIVFAREQSYIGTLVDDLCTKDLR
EPYRMLTSRSEYRLLLRSDNADQRLTTLGREIGLIDDRRWDLFTQKQANIITEKQRLQAT
RVKE-HD-EMGIAIASDTQQAIKGSITLNDLLRRPGFHYVDLDRF---GLGNPN----LN
R-AEKEGAEIDIKYYGYLARQQNQIDQIARQAHRQLPADLDYTTIDTLSKEAREKLTHVK
PLTLGQAARIGGVNPADVNALLLYLELRKINSQQEFPAL---------------------
---A
>gi|126655030|ref|ZP_01726469.1|	   634 residues, 50 /line  glucose-inhibited division protein A [Cyanothece sp. CCY0110]
------------------------------------------------------------
------------------MTLTTPVDFQDSFDIIVVGAGHSGCEAALAAARLGCRTLMLT
LNLDRIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRVLNSSRGPAVWALR
AQTDKREYSAVMKEIVENQ--------ENLSIREGMVTDLVLGKN---------------
-DEVIGIQTYFGTCFQAKAVILTTGTFLGGRIWIGNKSMEAGRAGEFAAVGLTDTLNDLG
FETGRLKTGTPARVDKRSVDYSKLEPQPPDEEVRWFSFD-P--EVWVEKEQMNCYLTRTT
TKTHQLIKDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKESHQIFIEPEGREIPELY
IQGFSTGLPENIQLAMLRTLPGLENCVMLRPAYAVEYDYLPATQCYPTLMTKKIQGLFCA
GQVNGTTGYEEAAAQGIVAGINAVKFVK-----NEEMIIFPREESYLGTLVDDLCTKDLR
EPYRMLTSRSEYRLILRSDNADQRMTPLGREIGLIDDRRWALFEHKQANIVAEKERLYET
RIKE-RD-EVAIKIVNDTQQKIKGSATLADLLRRPKFHYQHLEKY---GLGNQN----LT
I-VEKEGAEIDIKYSGYLKRQQIQIDQITRHSNKKLPSDLDYMAIDTLSMEAREKLTKVR
PLTLGQASRIGGVNPADINALLVYLELRSRYQSV--------------------------
----
>gi|16331425|ref|NP_442153.1|	   635 residues, 50 /line  glucose-inhibited division protein A [Synechocystis sp. PCC 6803]
------------------------------------------------------------
------------------MTLRSPVEFQDQFDVIVVGAGHAGCEAALATARLGCRTLLLT
LNLDRIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRVLNISRGPAVWALR
AQTDKREYAAVMKNIVENQ--------PNLSIREGMVTDLVLGDN---------------
-DEIQGVQTYFGACFGAQSVVITTGTFLGGKIWIGNKSMPAGRAGEFAAVGLTETLNELG
FETGRLKTGTPARVDRRSVDYDKLEPQPPDEQVSWFSFD-P--EVWVEREQMNCYLTRTT
AKTHQLIKDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKESHQIFIEPEGRDIPELY
IQGFSTGLPENVQLAMLQTLPGLENCVMLRPAYAVEYDFLPATQCYPSLMTKKVAGLFCA
GQINGTTGYEEAAAQGLVAGINAARHCQ-----GKSLIIFSREGSYLGTLIDDLCTKDLR
EPYRMLTSRSEYRLILRSDNADQRLTPLGREIGLIDDRRWDLFQTKQANITAEKERLYST
RIKE-QD-AVGKEIVDYTQQKIKGSIVLAELLRRPGFHYPDLEKF---QLGNEE----LK
P-EEKTSVEIEIKYSGYIKRQQTQIEQVSRHSQKRLPPGLNYMAIETLSMEAREKLTQFQ
PLTIGQAGRIGGVNPADINALLVYLETQLRRSVSP-------------------------
----
>gi|13812384|ref|NP_113502.1|	   649 residues, 50 /line  glucose inhibited division protein A [Guillardia theta]
MINNIISPKC-----------------------------------NKKI--------NIS
----------------KKKFSMVYNKHINSYDVIVVGGGHSGCEAAVASSKSGCKTLLIT
LNLDKIAWQPCNPSIGGPAKSNLVHEVDAIGGIIGKITDRTYLHKKLLNISKGPAVWALR
AQTDKREYSEEMKKFIDSE--------ENLSIQEGMVTQIFLDNN---------------
-KKIIGIGTHFGGFYRCRSVVLTTGTFLGGTIWVGPKKLSAGRSGEMASIGLTENLIKSN
IKFGRLKTGTPPRIDSRTIDYSKLEIQLSDQNELWFSFD-T--REWNSRETLPCYLTKTT
IETKNIIKQNLHLSPKYGGFMRSTGPRYCPSIEDKIVRFSNKDEHQIFLEPEGRNINEIY
LQGFSTGFPENLQENLIRTIEGLHSCRILRPAYSVDYDFLPATQLEKTLMSS-IEGLFFA
GQVCGTTGYEEASAQGIVTGLNASLYAQ-----KKSLLTISRQGSFIGTMIDDLVTRSLN
EPYRVLTSRSEYRMLLRGDNADIRLKPLGRKYGLVDDISWINFKKKVRDIKNKSLILNNT
IIKI-NS-NISGIIENELNVILKKDLSLASMISRPNVSFDSLINI---GIINSK-----N
I-EKLRILETEIKYQNYITRQNNQILSLERSLDLKIDKNFNFMDVNQISKEGREKLSKIR
PKTLREATCIGGISSSDLHILLIIVEKYKFKN----------------------------
----
>gi|27364443|ref|NP_759971.1|	   632 residues, 50 /line  glucose-inhibited division protein A [Vibrio vulnificus CMCP6]
------------------------------------------------------------
------------------------MLYHETFDVIVVGGGHAGTEAALASARTGQKTLLLT
HNIDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAQAIDHAGIQFRTLNASKGPAVRATR
AQADRALYKAYVRDFLENA--------PNLTLFQQAVDDLIVEQ----------------
-DQVRGVITQMGLKFHAKAVVLTVGTFLGGKIHIGLQSSSGGRAGDPPSIALADRLRELP
FRVDRLKTGTPPRIDARSVDFSVLEAQHGDNPTPVFSFM-G--DRTHHPRQIPCFITHTN
EQTHEVIRNNLDRSPMYAGIIEGIGPRYCPSIEDKVMRFADKNSHQIFIEPEGLTTHELY
PNGISTSLPFDVQVQIVRSMKGFENAHIVRPGYAIEYDFFDPRDLKQTYETKFIQGLFFA
GQINGTTGYEEAAAQGLMAGLNASLFSQ-----EKEGWSPRRDQAYMGVLIDDLSTMGTK
EPYRMFTSRAEHRLLLREDNADLRLTEKARELGLVDDARWARFNQKIDNMEQERQRLKST
WMNP-AS-TGIEELNQLLKSPMNREASGEDLLRRPEMTYEQLTSL---AAFAPA----LD
DLEAAEQVEIQVKYEGYIKRQQDEIEKSLRHEHTKLPADLDYSDVKGLSNEVVLKLNTAK
PETLGIASRISGITPAAISILLVHLKKIGMLKVGEEN-----------------------
---A
>gi|123967098|ref|YP_001012179.1|	   654 residues, 50 /line  Glucose inhibited division protein A [Prochlorococcus marinus str. MIT 9515]
------------------------------------------------------------
--------------------MKKQQSSNESFDVIVIGGGHAGCEAAITTAKLGFSTALFT
INLDRIAWQPCNPAVGGPAKSQLVHEVDALGGIIGKLADETAIQKRILNASRGPAVWALR
AQTDKREYSKRMIEILQNT--------DNLSLKEAMITELLIKEV-ETF----TKNSKNT
TKQIKGVKTFFGTCYSAKSIIITAGTFLEGRIWIGNKSMSAGRSGEQAAQGLTESLHSLG
IKTERLKTGTPARVDKKSISFDALDIQPSTASDKYFSFD-P--KIKNDMPQICCHITRTT
QKTHELIRNNLHLTPIYGGFIDSKGPRYCPSIEDKIVKFADKNSHQIFLEPEGINTPEIY
VQGFSTGLPENIQLELLRTLPGLNKCKMLRPAYAVEYEYIPATQLKLSLETIEIDNLFSA
GQINGTTGYEEAAAQGLVAGINATRKLN-----MKDPIIFSRESSYIGTMINDLITRDLK
EPYRVLTSRSEYRLTLRGDNADRRLTPLGFEIGLIDERRWFAHKEKMKLLKEENSRLENT
RLKC-TD-EIARNIELESGSKIKGSTTLKDLLKRPNVHYSDFIKY---DLANKS----LP
I-AVMEGVEIDIKYEGYLKRQQNNIDQINRQSLKSLPIEINYDLIDTLSLEARENLNKIK
PTNFGDASKIPGVSKADLTALLVWLKIKEIKKEKTNSFV-------------------EK
KLSS
>gi|91070437|gb|ABE11348.1|	   655 residues, 50 /line  glucose inhibited division protein A [uncultured Prochlorococcus marinus clone HOT0M-10E12]
------------------------------------------------------------
--------------------MQNHHSKNESFDVIVIGGGHAGCEAAITTAKLGFSTALFT
INLDRIAWQPCNPAVGGPAKSQLVHEVDALGGIIGKLADETAIQKRILNASRGPAVWALR
AQTDKREYSKKMIEILQNT--------DNLSLKEAMITELDIAKT-EEIG---LISKKIF
KKRIKGVRTFFGSYYSAKSVIITAGTFLEGRIWIGNKSMSAGRSGEQAAKGLTQNLHEIG
IKTERLKTGTPARVDKRSIIFDELDIQPSTAADKYFSFD-P--DIKNNMPQVSCHITRTT
TKTHQLIRDNLHLTPIYGGFIDSKGPRYCPSIEDKIVKFADKESHQIFLEPEGINTPEIY
VQGFSTGLPENIQLELLRTLPGLGECKMLRPAYAVEYDYIPATQLQTSLETKEIEYLFSA
GQINGTTGYEEAAAQGLVAGINATRKLN-----KKDPIIFTRESSYIGTMINDLITKDLK
EPYRVLTSRSEYRLTLRGDNADRRLTPLGYQIGLINEKRWSVYQEKMKLLEEEKFRLNNT
RLKN-TD-EISKKIELETGSKIKGSTTLKELLKRPNFHYSDLIKY---NLNERN----LG
S-SIQEGVEIDIKYEGYLKRQKNNIEQINRQSCKSLPEEINYEKIDTLSLEARENLNKIK
PKNFGDASKIPGVSKADLTALLVWLKIREIKKEKANIFV-------------------EK
KLSS
>gi|33241285|ref|NP_876227.1|	   667 residues, 50 /line  glucose-inhibited division protein A [Prochlorococcus marinus subsp. marinus str. CCMP1375]
------------------------------------------------------------
--------------------MSNYSNAKEKFDVIVVGGGHAGCEAAIATAKLGLSTALFT
LNLDRIAWQPCNPAVGGPAKSQLVHEVDALGGVIGRLADSTALQKRILNASRGPAVWALR
AQTDKRQYSIEMLQMLQET--------PNLSLREAMVTDLEIKSS-PNRKKIKEQSEEKT
IGQVQGIKTYFGSIYLAKAVILTTGTFLKGKIWIGNQSMDAGRAGEQAATGLTEALQKLG
FETSRLKTGTPPRVDRRTIDLGSLEEQKSDAADRFFSFD-P--ERWKSGQQMSCYMTRTT
QKTHQLIKNNLHLTPIYGGFINSKGPRYCPSIEDKIVRFSDKESHQIFLEPEGRNTPEIY
IQGLSTGLPEGMQLQLLRTLPGLKNCVMLRPAYAVEYDYLPATQLLASLETKKIEGLFSA
GQLNGTTGYEEAAAQGLVAGLNAARYVN-----NQDAIIFPREESYIGTMIDDLIKKDLR
EPYRVLTSRSEYRLILRGDNADRRLTPLGYKVGLVNDYQWNIFQIKQSNMEKEKKRLEQQ
RIKD-SD-PIALKIEKESGASIKGSITLANLLRRPGMHMNNLIRH---KLANNS----LP
L-DVREGVEIDIKYSGYLKRQNLQIEQIKKQNKRALPSEVNYTNIKTLSQEAREKLNATQ
PKTFGEASQLPGVSKADLSALLIWLKIQNRKSHAAKIRNNEAKI----------KLHSNL
GVDF
>gi|84519011|ref|ZP_01006360.1|	   657 residues, 50 /line  glucose-inhibited division protein A [Prochlorococcus marinus str. MIT 9211]
------------------------------------------------------------
--------------------MNKLLDATESFDVIVVGGGHAGCEAAITTAKLGFSTALFT
LNLDRIAWQPCNPAVGGPAKSQLVHEVDALGGVIGRLADTTAIQKRILNASRGPAVWALR
AQTDKRQYVKQMLQLLQNT--------PNLHLREAMVTGLEVDPN-NS--KVS---NENH
TGWIKGIKTYFGSIYLAKAVILTTGTFLRGRIWIGNQSMAAGRAGEQPAEGLTEALQELG
FQTDRLKTGTPARIDRRSINLHALEEQKSDAANRFFSFD-P--TAWKSGKQISCHITRTT
TATHQLVKDNLQHTPIYGGFIDSKGPRYCPSIEDKIVRFSDKESHQIFLEPEGLDTPEIY
VQGFSTGLPEKLQLKLLQTLPGLEKCIMLRPAYAVEYDYIPATQLLPSLETKKIKGLFSA
GQLNGTTGYEEAAAQGLVAGINATRLIQ-----QKEALHFPREESYIGTMIDDLVHKDLR
EPYRVLTSRSEYRLLLRGDNADRRLTPLGHKLGLIDQRRWDIFKAKHNALNNEKIRLETQ
RVKA-SD-SIALELEKETGAAIKGSISLANLLRRPGTHMSTLLRY---QLINND----IP
L-DVREGVEIDIKYSGYLERQKAQVDQIQKQSKKPIPTEINYESITTLSKEAREKLTIRR
PKNFGEAGLIPGVSKADLTALLVWLKIQNRKQLEKAKPNIK---------------QSTP
GGSF
>gi|113955354|ref|YP_731984.1|	   649 residues, 50 /line  glucose-inhibited division protein A [Synechococcus sp. CC9311]
------------------------------------------------------------
--------------------MSFSPPPTEVFDVIVVGGGHAGCEAAITAARLGLSTALFT
LNLDRIAWQPCNPAVGGPAKSQLVHEVDALGGVIGRLADATAIQKRVLNASRGPAVWALR
AQTDKRHYSREMLQLLHHT--------PNLALREAMVTGLEVDGD-PEPAGQ--------
-ARITGVRTYFGSVYGAQAVVLTAGTFLGGRIWVGHQSMSAGRAGEQAAEGLTDALKQLG
FQTDRLKTGTPARVDRRSIALDQLEAQPSDAADRFFSFD-P--TAWASGEQMSCHITRTT
AATHQLIKDNLHLTAIYGGIIDSKGPRYCPSIEDKIVRFADKDSHQIFLEPEGRDTPEIY
VQGFSTGLPETIQLELLRTLPGLEQCVMLRPAYSVDYDYLPATQLKPSLETKRVRGLFSA
GQLNGTTGYEEAAAQGLVAGLNAARLIG-----GQEPVHFPRENSYIGTMIDDLVSQDLR
EPYRVLTSRSEYRLVLRGDNADRRLTPLGRELGLIDDRRWQLFNDKLQAMEEEKQRLETV
RLKV-SD-PVASTVEKESGAPIRGSITLADLLRRSGVHSSDLVRH---RLADAE----LP
L-AVREGAEIDIKYSGYLQRQQQQIDQVKRQSLRKLPADLDYASIGTLSREAREKLTAIQ
PTTLGQATHIPGVSQADLTALLLWLELQKRRSQKSESLAS-------------------S
TNSR
>gi|148240756|ref|YP_001226143.1|	   659 residues, 50 /line  Glucose inhibited division protein A [Synechococcus sp. WH 7803]
------------------------------------------------------------
--------------------MANSFSPTEIFDVIVVGGGHAGCEAAITSARLGLNTALFT
LNLDRIAWQPCNPAVGGPAKSQLVHEVDALGGVIGRLADATAIQKRILNASRGPAVWALR
AQTDKRQYSRQMLQLLQHT--------PNLALREAMVTGLEIDGD-PAGGGEHWDPSQGP
AARITGVRTYFGSLYGAKAVVLTAGTFLGGRIWVGHQSMAAGRAGEQAAEGLTEALQQLG
FHTDRLKTGTPARVDRRSIALDQLEEQPSDAADRFFSFD-P--AAWSSGEQMSCHITRTT
AATHQLIKDNLHLTAIYGGVIDSKGPRYCPSIEDKIVRFADKDSHQIFLEPEGRDTPEIY
VQGFSTGLPEPIQLQLLRSLPGLEQAVMLRPAYSVDYDYLPATQLLPSLETKRVQGLFSA
GQLNGTTGYEEAAAQGLVAGLNAARRIR-----AEEAVHFPREGSYIGTMIDDLVSKDLR
EPYRVLTSRSEYRLVLRGDNADRRLTPLGRELGLIDDRRWRLFEDKLQAMEAEKQRLEQQ
RLKV-SD-PAAPAVEQETGAPIKGSITLADLLRRPGMHAADLVRH---GLADAG----LP
L-PVREGAEIDIKYSGYLARQQQQIDQVKRQGRRKLPETIDYASISTLSREAREKLTAVR
PLTLGQASQIPGVSQADLTSLLMWLELQQRRSQPSASHLA------------------PT
GQAR
>gi|124024586|ref|YP_001018893.1|	   653 residues, 50 /line  Glucose inhibited division protein A [Prochlorococcus marinus str. MIT 9303]
------------------------------------------------------------
--------------------MPFSAPPTEHFDVIVVGGGHAGCEAALTAARLGLSTALFT
LNLDRIAWQPCNPAVGGPAKSQLVHEVDALGGVIGRLADATALQKRVLNASRGPAVWALR
AQTDKRLYSRQMLQLLQQT--------ANLSLREAMVTGLEVKGD-PSGGGEHWEPAQGH
AAQITGVRTYFGSIYRAQAVVLTTGTFLGGQIWVGNQSMPAGRAGEQAAEGLTEALESLG
FQTNRLKTGTPARVDRRSIALDQLEEQPSDAADRFFSFD-P--TTWVSGEQMSCHITRTT
ASTHQLIKENLELTPIYGGFLDSKGPRYCPSIEDKIVRFADKDSHQIFLEPEGRDTPEIY
VQGFSTGLPERLQLDLLRTLPGLEQCIMLRPAYAVDYDYLPATQLSPSLQTKRVKGLFTA
GQLNGTTGYEEAAAQGLVAGLNAARLVH-----GQEQVHFPREGSYIGTMIDDLVSKDLH
EPYRVLTSRSEYRLILRGDNADRRLTPLGYQLGLIDARRWQLFQSKQTALEDEKQRLEKQ
RIKA-SD-PAAPALEAKTGAKIKGSITLADLLRRPGVHSADLIEH---GLVDPE----LA
L-GVREGAEIDIKYSGYLQRQQQQIDQLKRQSQRRLPANLDYANISTLSKEAREKLTAVG
PLNFAQASQIPGVSKADLTALLVWLELQKRRTLAASGH----------------------
--DR
>gi|124026850|ref|YP_001015965.1|	   656 residues, 50 /line  Glucose inhibited division protein A [Prochlorococcus marinus str. NATL1A]
------------------------------------------------------------
--------------------MITKQSSNESFDVIVVGGGHAGCEAALTSARLGLNTALFT
LNLDRIAWQPCNPAVGGPAKSQLVHEVDALGGIIGKLADLTALQKRVLNASRGPAVRALR
AQTDKRSYAHEMLKILQNT--------PNLKIREAMVTGLEIEHY-PNQIDQKTPEIQER
IGFIKGIKTYFGSVFHAKAVVLTTGTFLGGRIWIGNQSMSAGRAGEQASEGLTEELKKLG
FTTDRLKTGTPARVDRRTIDLDSLDEQLSDASDKFFSFD-P--LSWKSGEQMSCHITRTT
KETHQLIKNNLHLTPIYGGFIDSKGPRYCPSIEDKIVRFADKDSHQIFLEPEGRDTPEMY
VQGFSTGLPENLQLELLRTLPGLQNCVMLRPAYAVEYDYIPATQLEATLETKRISGLYSA
GQLNGTTGYEEAAAQGLVAGLNAARLVN-----NKEGIIFERESSYIGTMIDDLVTKDLK
EPYRVLTSRSEYRLILRGDNADRRLTPLGYQLGLIDERRWNIFNAKQQLINQEKERLDKE
RIKE-SD-KCAKEIFSSTGTPIKGSLTLANFLRRTNIHYKDLITY---NLTTQS----IP
L-DVEEAVEIDIKYSGYLERQKAQINQLKQQSKKLLPKNLNYNNIETLSKEAREKLTISQ
PKSLGHAAQVPGVSKADLTALLVWLKIEKMKKVKRKDSL---------------------
QITN
>gi|145347894|ref|XP_001418395.1|	   693 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
MVVSARGPCAPSTSASTLVARP----RSRLRGAVVA-------------IARPNRRRVVV
ARA---------------SASSSRPPADARYDVIVVGAGHAGCEAALASARAGASTLLLT
LNLDRVAWQPCNPAVGGPAKSQLVHEIDALGGAMGIISDKTYLQKRVLNASRGPAVWALR
AQTDKWEYSREMRTTLEAE--------PNLSIREGMVTELVLGTN---------------
-DDVRGVRTHFGMEFEAPSVVLTTGTFMGGQIWVGRKTLAAGRAGEAPSEGLTEYLQEIG
FEIDRLKTGTPARVDSRSIDYTNLEEQPGDEDMRWFSFD-E--DAHVVREQMACHMTRTT
AATHKLIQDNLLETPTYGGWVGAKGPRYCPSIEDKIVRFADKESHQIFLEPEGRTVPEVY
VQGFSTGLPETLQLELLRTLPGLENCKILRPAYAVEYDFLPAYQCKPTLETKKISGLFFS
GQINGTTGYEEAAAQGLLAGINAAQLAKGGASNGAKELILPREGSYLGTLVDDLCTKDLR
EPYRMLTSRSEYRLVLRSDNADMRLTPLGREVGLISDARWAKFEKKRDAVDNEMARLQST
RLNV-KD-EFCQRALDVSGSGSRQSYTLEELLRRPQVPYSMLEEF---GQGNVDA--PLT
R-WEAEAVEIRVKYSGFIKRQELQVERESSKFGKPIPDDVDYASISTLRMEAREKLARVR
PATIGQASRIGGVTPADVSSLLVHLEVRRRNAERAESPS---------------------
---A
>gi|148243498|ref|YP_001228655.1|	   643 residues, 50 /line  Glucose inhibited division protein A [Synechococcus sp. RCC307]
------------------------------------------------------------
--------------------MEPAALPTESFELIVVGGGHAGCEAALTAARLGISTALFS
LNLDRIAWQPCNPAVGGPAKSQLVHEVDALGGVIGRLADATALQKRVLNASRGPAVWALR
AQTDKRQYARQMLQLLQHT--------PNLALREAMVTGLETSGS-AESG----------
DLRITGVRTYFGSIYNAQAVVLTTGTFLGGRIWVGNQSMPAGRAGEQPAEGLTEALQALG
FATDRLKTGTPARVDRRSVALETLEEQPSDAHERWFSFD-P--EAWVSSEPMSCHITRTT
AATHQLIKDNLHLTPIYGGFIDSKGPRYCPSIEDKIVRFADKDSHQIFLEPEGRDTPELY
IQGFSTGLPERLQLKLLRTLPGLEQCVMLRPAYNVEYDYLPATQLLPSLQTKRVAGLFSA
GQLNGTTGYEEAAAQGLVAGLNAVRLIR-----GQTPVHFPREGSYIGTLIDDLVTKDLR
EPYRVLTSRSEYRLVLRGDNADRRLTPLARELGLIDARRWQIYERKQEGIAAETKRLETV
RLKV-SD-PVAPAVVEQTGAAIKGSITLADLLRRPGFHSNDLVRH---GLADGE----LP
V-DVREGAEIDVKYSGYLARQTQQIERVQRQGQRLIPSGIDFYSITTLSREARERLTAAQ
PLNLGQASRLPGVSPADVTALLLWLELQDRQAATTTLAR---------------------
---P
>gi|87302071|ref|ZP_01084905.1|	   662 residues, 50 /line  glucose-inhibited division protein A [Synechococcus sp. WH 5701]
------------------------------------------------------------
--------------------MALSAAPSETFELIVVGGGHAGCEAALTAARLGISTALFS
LNLDRIAWQPCNPAVGGPAKSQLVHEVDALGGVIGRLADATTLQKRVLNASRGPAVWALR
AQTDKRQYARQMLQLLQHT--------PNLHLREAMVTGLEVDLE-GNGPN---QVGNGA
VGRITGVRTFFGSVYAAPAVILTTGTFLGGQIWVGNQSMSAGRAGEQASEGLTEALQALG
FHTDRLKTGTPARVDRRSVALDQLEEQPSDAEGRYFSFD-P--AAWVSSEPMACHLTRTT
AATHQLIRDNLHLTPIYGGFIDSKGPRYCPSIEDKIVRFADKPSHQIFLEPEGRDTPELY
IQGFSTGLPERLQLELLRTLPGLEHCVMLRPAYAVEYDYLPATQCLPSLMTKRVRGLFSA
GQLNGTTGYEEAAAQGLVAGLNAARLLR-----GQEPVHFPREGSYIGTLIDDLVTKDLH
EPYRVLTSRSEYRLVLRGDNADRRLTPLGRELGLIDDRRWGLFEAKQAAIAAEKQRLETV
RLKV-SD-PVAPEAEARSGAPIKGSITLADLLRRSGFHSRDLVDL---GLADAD----LP
A-GVREGAEIDLKYSGYLARQQQQIDQVRKQDQRPIPGGIDYSAIATLSKEAREKLAAVQ
PLNLGQASRIPGVSPADTTALLLWLELRRRRECQQERLSNRETTTTIAK-----------
-IHS
>gi|22298078|ref|NP_681325.1|	   637 residues, 50 /line  glucose-inhibited division protein A [Thermosynechococcus elongatus BP-1]
------------------------------------------------------------
--------------------MSTLPAFQDEFDVIVVGAGHAGCEAALATARLGCRTLLLT
LNLDKIAWQPCNPAVGGPAKSQLVHEVDALGGEIGRVSDRTYVQKRLLNASRGPAVWALR
AQTDKREYSAVMKQVVENQ--------PNLLVREGMVTDLVLDAN---------------
-DTVIGVETYFGVAFRCQAVILTTGTFLGGRIWVGNKSMPAGRAGEFAAEGLSQTLARLG
FEVDRLKTGTPARVDRRSVDYSKMEPQPPDEQVRWFSFD-P--TVWVERPQMNCYLTRTT
PETHRLIREHLHLTPVYGGWVDAKGPRYCPSIEDKIVRFADKESHQIFIEPEGRNTPELY
IQGFSTGLPEPLQLQLLRTLPGLENCIMLRPAYAVEYDYLPATQCFPTLMTKKIQGLFCA
GQINGTTGYEEAAAQGIVAGINAARFVQ-----RKPMITFPRQESYIGTLIDDLCTKELR
EPYRMLTSRSEYRLVLRSDNADQRLTPLGYEIGLVSEAQWQVFQAKQRRLAAETQRLQTT
RIKA-HE-PVGEAIVTATGQAIKSAIALEELLRRSGVHYELLDRH---GLGNPD----LT
P-QEKEAVEIAIKYAGYIERQQREIEQIARQEQRPLPVDLDYFAIPTLSMEAREKLSAIR
PLTIGQASRIGGVNPADINALLVYLQVQQQRQSLTAV-----------------------
--GG
>gi|37520450|ref|NP_923827.1|	   656 residues, 50 /line  glucose-inhibited division protein A [Gloeobacter violaceus PCC 7421]
-------M----SCL-----------------------------------------PDWL
AAGCRDGDAASHPTI-RLRFRTATVHYLAEFDVVVVGAGHSGCEAALAAARLGCRTLLVT
MNLDTIAWQPCNPAVGGPAKSQLVHEVDALGGEMAKITDRTYLQKRVLNSSRGPAVWALR
AQTDKREYARELKQVLEAT--------PNLTLRQGQITDIHLGPH---------------
-DEICGVGTFFDVHFACRAVILTTGTFLGGRIWIGRKSMSAGRAGEFAAEGLTATLERLG
FETGRLKTGTPARVDRRTVDFGVMEVQPPDPELRWFSFD-P--RAWVEREQLNCYLTRTT
AATHQVIRDHLHLSPMYSGDIEARGPRYCPSIEDKIVRFADKESHQIFIEPEGRDTPELY
VQGFSTSLPETVQIAMLRTLPGLEACAVLRPAYAVEYDYLPATQCYATLMTKRVEGLFCA
GQINGTTGYEEAAAQGIVAGINAARLVR-----GEALVILPREGSYIGTLIDDLVTKEIR
EPYRMLTSRSEYRLVLRSDNADRRLTPLGREIGLVDDERWGLYQKKIAAITCERQRLETT
RLNA-RD--LPVHL-----AAKPGSITLADLLRRPGLHYGDLESL---NQG-VL----LD
A-QVREGVEIEVKYSGYIERQNEQIERVSAQHARVIPADLDYERLSTLSKESREKLNRIR
PRTIGQAGRIGGVNPADVSALLVYLELAQAGRLTPAA-----------------------
---P
>gi|81301232|ref|YP_401440.1|	   635 residues, 50 /line  glucose inhibited division protein A [Synechococcus elongatus PCC 7942]
------------------------------------------------------------
------------------------MPHTEEFDVIVIGAGHAGCEAALAAARLGCQTLLLT
LNLDRIGWQPCNPAVGGPAKSQLAHEVDALGGEIGKMADRTYLQKRVLNASRGPAVWALR
AQTDKREYAAVIKQVLEQQ--------PNLRLREGMVTDLLIGPN---------------
-DEVQGVTTYFGSSFRAKAVILTTGTFLGGCIWVGNKSMPAGRAGEFAAVGLTETLQRLG
FETDRLKTGTPARVDKRSVDYSRLEPQPGDPEVRWFSFD-P--EAWVEREQLPCYLTRTT
AETHKLIRDNLHLTPVYGGYIDAKGPRYCPSIEDKIVRFADKESHQIFIEPEGRDIPELY
IQGFSTGLPEDLQLALLQTLPGLEDCVMLRPAYAVEYDYLPATQCLPTLMTRRVEGLFSA
GQLNGTTGYEEAAAQGIVAGINAARFVQ-----GQDAIVFPREGSYIGTLIDDLCTKDLR
EPYRVLTSRSEYRLLLRADNADQRMTPLGREIGLIDDRRWALFEQKQARIAAEQTRLTQQ
RVKE-HD-PVGQAIAQQTQAPIKGSATLADLLRRPNFHYIDLEAH---GLGDPS----LA
I-AEKEGAEIAIKYAGYLQRQQAQVDQVVRQSQRPLPVDLDYSAITSMRLEAREKLARFR
PLTLGQASRIGGVNPADINALLIWLEVQERQRSQVETA----------------------
-LVR
>gi|86605018|ref|YP_473781.1|	   643 residues, 50 /line  glucose-inhibited division protein A [Synechococcus sp. JA-3-3Ab]
------------------------------------------------------------
----------------MLKVGRDNVDFLDHYDVIVVGGGHAGCEAALAAARLGCNTLMLT
LNLDKIAWQPCNPAVGGPAKSQLVHEIDALGGEMGKVTDRTYLQKRVLNRSRGPAVWALR
AQTDKREYARVMRSVVENQ--------PNLSIREGTVTDLVLGRN---------------
-DEVVGVVTHFGSVFGCGAVILTTGTFLGGRIWIGRHWQPAGRAGEFAVEGLTDTLRQLG
FETGRLKTGTPARVDRRSVDFSVMERQPGDPDLRWFSFD-P--EVWVPREQMDCYLTRTT
PETHRIIRENLHETPVYGGWVEAKGPRYCPSIEDKIVRFADKESHQIFIEPEGRDLPELY
IQGFSTGMPEKIQIQMLRSLPGLERCVMLRPAYAVEYDYLPATQLYPTLMTKKVQGLFCA
GQINGTTGYEEAAAQGLIAGINAARLVQ-----GKPLVTLPRESSYIGTLIDDLCTKELR
EPYRMLTSRSEYRLILRADNADQRLTPLGREWGLIDDRRWALFQAKQARIAAEIERLETQ
RVKA-HD-PAGIHLSQLTGQGIKGSATLAELLRRNPIHYADLLEL---GLGNEE----LD
P-FEQEAAEIAVKYSGYIQRQQAQIEQVSKQYHRPLPPDLDYHSIPTLSKESREKLAAVR
PLTVGQAARIGGVNPADINALLIYLEVRQRQKTAAAA-----------------------
PVGA
>gi|115442371|ref|NP_001045465.1|	   717 residues, 50 /line  Os01g0960300 [Oryza sativa (japonica cultivar-group)]
MLLRLRPP----PQPAASL--ASFLPFSPFRRFLHSPSWRP-------PPPPPPRRHRLL
STAVA----------SSSSSSKVSTSLEERYDVIVVGGGHAGCEAALASARLGARTLLLT
LNIDRIAWQPCNPAVGGPAKSQLVHEVDALGGEMGKIADRCYLQKRVLNSSKGPAVRALR
AQTDKREYAVEMKKVVEST--------QNLFIREAMATEVMIGQN---------------
-DNVEGVRTFFGMDFYAPSVVLTTGTFMSGKIWVGRTSMPAGRAGESASHGLTENLQQLG
FETDRLKTGTPPRIDRRTVNFSGLEPQHGDEEVGWFSFD-P--EFHIERDQMCCYLTRTT
KETHQIVRDNLDETPTYGGWVEAKGPRYCPAIEDKIVRFKDKESHQVFLEPEGRDVPELY
LQGFSTGLPERLQLSLVRTLPGLENCVMLRPAYAVEYDYLPAYQCSRSLMTKKFEGLFFS
GQINGTTGYEEAAAQGIISGINAARHSD-----GKPLIILERESSYIGTLIDDLVTKDLR
EPYRMLTSRSEHRLLLRADNADSRLTPLGRDIGLIDDRRWELYQSKQARIKEEKERLKST
KIPG--G-EFAAAVTSVSNQPVKESSTLEAILKKPHVQYKLLDKH---GYGNEH----LS
R-IEKECVEIDIKYEGFIARQQSQLQQIVNQEHKKLPEDLDYHSMTNLSLEAREKLSKVR
PQTIGQASRIGGVSPADMTVLLIWMESNRRMANYKRQQSTLRSAATKADDSSDEVV-HAS
ATNA
>gi|144924597|gb|ABP03419.1|	   735 residues, 50 /line  Pyridine nucleotide-disulphide oxidoreductase, class I; Glucose-inhibited division protein A subfamily [Medicago truncatula]
-------M----STVPFTL---HFSRFNRNLRKTLFPTSSITLFYPPSLNFRLTTRRKIS
FSASTFSRRFSTVTSASSSRDLDYEFGTEKYDVIVVGGGHAGCEAALASARLGARTLLLT
LNIDRIAWQPCNPAVGAPAKSQLVHEVDALGGDIGKIADRCYLQKRVLNSSKGPAVRALR
AQTDKREYALVMKNVVERQKHQVFCSTPNLSIREAMVTDILLGKN---------------
-DNVEGVCTFFGMKFYAPSVILTTGTFMSGKIWVGRTSMPAGRAGESASHGLTENLQQLG
FETDRLKTGTPARVDIRTVDFSGLESQPGDEEVSWFSFD-P--DVHIEREQMCCYLTRTT
SATHQIIRDNLHETPTYGGWVEAKGPRYCPSIEDKIVRFQDKESHQIFLEPEGRDVPELY
VQGFSTGLPERLQLPLLRTLPGLENCSMLRPAYAVEYDYLPAHQCSRSLMTKKIEGLFFS
GQINGTTGYEEAAAQGIISGINAARHAD-----GKSLIVLERESSYIGTLIDDLVTKDLR
EPYRMLTSRSEHRLLLRSDNADSRLTPLGREIGLIDDRRWKLYQEKQARISEEKKRLKSV
KISG-GD--LAAEITVMSGQPVKNSSTLESLLKKPHIQYGLLDKH---GFGDKN----LS
R-MEKECVEIDIKYEGFILRQQSQLQQMVTQQHKPLPEDLDYYAMINLSLEAREKLSKVR
PQTIGQASRVGGVSPADITALLIELEAKRRKAQGQRRYKMINAIEANTQDEEPEVSLTET
ARSG
>gi|116496319|ref|YP_808053.1|	   633 residues, 50 /line  tRNA uridine 5-carboxymethylaminomethyl modification FAD-utilizing enzyme [Lactobacillus casei ATCC 334]
----------M-------------------------------------------------
--------------------PDVKKFEAGTYDVIVVGAGHAGCEAALAAARMGQKTLLLT
ISLEMLAFMPCNPSLGGPAKGIVVREIDALGGEMGKNIDRTYIQMRMLNTGKGPAVRALR
AQADKAAYHRSMKHVIENT--------PNLDLRQGLATEVLV-EN---------------
-GQAVGIVAATGAMYRAKSVVLTAGTSSRGKIIIGELMYSSGPNNSLPSIKLSENLEQLG
FKLRRFKTGTPPRVNGNTIDFDKTEEQPGDKTPNHFSFTTP--DSVYLKDQLSCWMTYTN
ATTHQIIRDNLDRAPMFSGVIKGVGPRYCPSIEDKIVRFADKPRHQLFLEPEGRDTSEYY
VGDFSTSMPEEIQLKMLHSVAGLEHAELMRAGYAIEYDVIEPWQLKATLETKVVDNLFTA
GQMNGTSGYEEAAGQGIMAGINAALRAQ-----GKGPFTLKRSDAYIGVMIDDLVTKGTN
EPYRLLTSRAEYRLLLRHDNADLRLKPMGHELGLISDERYAEFLAKRQAIETELNRLNTT
RLKP-KD--VNPWLEAHHYAPLKDGVLASDFLKRPEIDYQTMAQF---LPDNPT----LD
H-RVIEQVEIQIKYAGYIAKEEASVAKLKRLEGKKIPLRINYAAINGLATEARQKLVKIQ
PETIAQASRISGVNPADVAILSVYIEQGRISKVAQ-------------------------
----
>gi|27262248|gb|AAN87405.1|	   643 residues, 50 /line  glucose-inhibited division protein A [Heliobacillus mobilis]
----------ME-------------------------------------------N----
------------------EGVAMLEYLAGQYDVIVIGAGHAGCEAALAAARMGCKTLILT
ISWDNVALMPCNPAIGGPAKGHLVREIDALGGQMGVTIDATAIQIRMLNTGKGPAVHALR
AQADKKKYQQYMIQVLEHQ--------ENLDVRQAMVETIRV-ED---------------
-GQVQGVLTQTGAFFAAPNVVITSGTYLKGRIIIGDLHYPGGPNGYFPSTELAASLREVG
VQLGRFKTGTPARVDGRTVDFTKMVEQPGDSDPLNFSFIS----SRFERKQISCWLTYTT
EETHQIIRDNLHRSPLYAGVIEGTGPRYCPSIEDKVVRFADKKSHQVFVEPEGADTHEMY
VQGMSTSLPEDIQLAMLRSIIGMENVKIIRPGYAIEYDYVVPTQLKLSLEHQTIQGLFTA
GQVNGTSGYEEAAAQGIIAGINAACRAQ-----GKEPLILKRSDAYIGVLIDDLVTKGTN
EPYRMLTSRAEYRLLLRQDNADQRLTEIGCSIGLVDDVRYERFQRKMERVEQEKELWSKT
FVTP-GNIRLQEILEQKRSAPLTKGLSLFDLLRRPELSFDDLHSLLEYDEARET----VD
P-EVAEQVEISAKFEGYLVKQQAQVERFNKLESRRVPPDLDYALIGGLSTEARQKLIARR
PESLGQASRISGVNPADISLLLVYLEQRRRRDNGGNG-----------------------
---E
>gi|69247495|ref|ZP_00604365.1|	   633 residues, 50 /line  Glucose-inhibited division protein A subfamily [Enterococcus faecium DO]
------------------------------------------------------------
----------------------MEHYEADAYDVIVVGAGHAGSEAALAAARMGSKTLLLT
INLDMVAFMPCNPSVGGPAKGVVVREIDALGGEMGKNIDKTYIQMRMLNTGKGPAVRALR
AQADKHAYSTEMKHTIEKE--------PNLTLRQGIVEELIV-ED---------------
-GVCHGVVTSTGASYRAKAVVITAGTALRGEIIIGELKYSSGPNNSQPSIGLANHLKELG
FAIERFKTGTPPRVKSSTIDYSVTEEQPGDKEPNHFSFSTP--DSAYKLDQESCWLTYTG
ETTHQIIRDNLHRAPMFTGIVEGVGARYCPSIEDKIVRFADKPRHQLFLEPEGLNTEEVY
VQGLSTSLPEDVQVNMLHSIAGLEKVEMMRTGYAIEYDVVEPHQLRPTLETKVVENLYTA
GQTNGTSGYEEAAGQGLIAGINAALKVQ-----GKEPLVIKRSDGYIGVMIDDLVTKGTN
EPYRLLTSRAEYRLLLRHDNADLRLTEMGHRVGLVKEDQYKNYLKKKEAVEQEIKRLMNV
RIKP-TE-EVQDFLATINAAPLKDGVLASDFLRRPEITYAELLRF---IPENEE----LT
R-KEIEQVEVQIKYEGYIKKAMEKVEKLKRMEAKKIPENIDYAAINGLATEAKQKLQKIQ
PETIAQASRISGVNPADLSILMVYIEQGKIAKVSEP------------------------
---A
>gi|116628660|ref|YP_821279.1|	   633 residues, 50 /line  tRNA uridine 5-carboxymethylaminomethyl modification FAD-utilizing enzyme [Streptococcus thermophilus LMD-9]
------------------------------------------------------------
----------------------MSYEFDENFDVIVVGAGHAGVEASLAAARMGCKVLLAT
INLEMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALR
AQADKALYAMTMKHTVECQ--------ENLTLRQSMVDEILV-ED---------------
-SKVVGVRTATNQKYGAKAVVVTTGTALRGEIIIGDLKYSSGPNNSLASVTLADNLKELG
LEIGRFKTGTPPRVKASSINYEETEIQPGDEKPNHFSFLSK--DEDYLQDQIPCWLTYTN
QESHDIINNNLHRAPMFSGIVKGVGPRYCPSIEDKIVRFADKNRHQLFLEPEGRETEEVY
VQGLSTSLPEDVQKELIHSIKGLEKAEMIRTGYAIEYDIVLPHQLRATLETKLISGLFTA
GQTNGTSGYEEAAGQGLVAGINAALKVQ-----GKPELILKRSDAYIGVMIDDLVTKGTL
EPYRLLTSRAEYRLILRHDNADMRLTPIGREVGLVDDERWNIFKIKKNQFDRELTRLSKE
KLKP-IK-ETNEKIQALGFKPLTDAMTAKEFMRRPEIDYATATQFV--GPAAED----LD
A-KVIELLETEIKYEGYINKALDQVAKMKRMEEKKIPENIDWDAIDSIATEARQKFKKIN
PETIGQASRISGVNPADISILMVYLEGNNKARRKV-------------------------
---D
>gi|21911374|ref|NP_665642.1|	   632 residues, 50 /line  glucose-inhibited division protein A [Streptococcus pyogenes MGAS315]
------------------------------------------------------------
----------------------MTHEFTESYDVIVIGAGHAGVEASLATSRMGCKTLLAT
INLDMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALR
AQADKSLYAREMKHTVEKQ--------ANLTLRQTMIDDILV-ED---------------
-GRVVGVLTATGQKFAAKAVVVTTGTALRGEIILGELKYSSGPNNSLASVTLADNLKKLG
LEIGRFKTGTPPRVKASSINYDQTEIQPGDDKPNHFSFMSK--DADYLKDQIPCWLTYTN
QTSHDIINQNLYRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRDTEEVY
VQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIEYDIVLPHQLRATLETKLISGLFTA
GQTNGTSGYEEAAGQGLIAGINAALKVQ-----GKSELILKRSDAYIGVMIDDLVTKGTL
EPYRLLTSRAEYRLILRHDNADMRLTEIGRDIGLVDDERWKAFEIKKNQFDNELKRLNSI
KLKP-VK-ATNDRVQELGFKPLTDAMTAKEFMRRPEIDYAIAVSFV--GPAAED----LD
A-KIIELLETEIKYEGYIRKALDQVAKMKRMEEKRIPANIDWDAIDSIATEARQKFKKIN
PETIGQASRISGVNPADISILMIYLEGNGKAHRKY-------------------------
----
>gi|125719133|ref|YP_001036266.1|	   635 residues, 50 /line  Glucose inhibited division protein A, putative [Streptococcus sanguinis SK36]
------------------------------------------------------------
----------------------MSHNFTESYDIIVIGAGHAGVEASLAASRMGCKVLLAT
INIEMLAFMPCNPSIGGSAKGIVVREVDALGGEMAKNIDKSYIQMKMLNTGKGPAVRALR
AQADKELYSKEMRKTVENQ--------ENLTLRQTMINEILV-ED---------------
-GKVIGVKTATHQEYAAKAVIVTTGTALRGEIIIGDLKYSSGPNHSLAAIPLADNLRDLG
FEIGRFKTGTPPRVKASSINYDVTEIQPGDEKANHFSYTSR--DEDYVKDQVPCWLTYTN
AESHEIIQNNLHRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRDTEEVY
VQGLSTSLPEDVQKDLVHSIKGLENAEMMRTGYAIEYDMIMPHQLRATLETKKISGLFTA
GQTNGTSGYEEAAGQGIIAGINAALKIQ-----GKQELILKRSDGYIGVMIDDLVTKGTV
EPYRLLTSRAEYRLILRHDNADMRLTEMGREIGLVDDERWARFEIKKNQFDNEMKRLESI
KLKP-VK-ETNAKVEALGFKPLTDAVTAKEFMRRPEVSYQDVVQFI--GPAAEE----LD
E-KIIELIETEIKYEGYISKALDQVEKMKRMEEKRIPANIDWDDIDSIATEARQKFKKIN
PETIGQASRISGVNPADISILMVYLEGKSRSISKNQA-----------------------
---K
>gi|146319817|ref|YP_001199529.1|	   638 residues, 50 /line  NAD/FAD-utilizing enzyme apparently involved in cell division [Streptococcus suis 05ZYH33]
------------------------------------------------------------
----------------------MTHTFAENYDVIVIGAGHAGVEAGLAASRMGCKTLLAT
INLDMVAFMPCNPSIGGSAKGIVVREIDALGGEMGRNIDKTYIQMKMLNMGKGPAVRALR
AQADKAEYASEMKRTVERQ--------ENLTLRQTMIDEILV-ED---------------
-GKVIGVRTATNQKFSAKAVVVTTGTALRGEIIIGDLKYSSGPNNSLASITLADNLKELG
LEIGRFKTGTPPRVNARTINYEDTEIQPGDEKPNHFSFLSK--DEDYLLDQIPCWLTYTN
ATSHEIINSNLHRAPMFSGIVKGIGPRYCPSIEDKIVRFADKERHQLFLEPEGRNTDEIY
VQGLSTSLPEDVQQDLIHSIKGLENAQMMRTGYAIEYDMVMPHQLRATLETKKISGLFTA
GQTNGTSGYEEAAGQGIVAGINAALKVQ-----GKPELILKRSDGYIGVMIDDLVTKGTV
EPYRLLTSRAEYRLILRHDNADMRLTEIGRQVGLVDDERWQVFQIHKNQFDNEMKRLESI
KLKP-IK-ETNEKVVAMGFKPLTDALTAKEFMRRPDVTYADAVAFI--GPAAED----LD
A-KTIELIETEVKYEGYIAKALDQVEKMKRMEEKRIPADIDWDDIDSIATEARQKFKLIS
PETIGQASRISGVNPADISILMVYLEGRSRSISKNKSKD---------------------
--SH
>gi|76786721|ref|YP_330690.1|	   633 residues, 50 /line  glucose-inhibited division protein A [Streptococcus agalactiae A909]
------------------------------------------------------------
----------------------MTHNFAENYDIIVVGAGHAGVEASLAASRMGCKTLLAT
INLEMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALR
AQADKALYAQTMKQTVEKQ--------ENLTLRQAMIDEILV-ED---------------
-GKVVGVRTATNQKFSAKSVVITTGTALRGEIILGELKYSSGPNNSLASVTLADNLRDLG
LEIGRFKTGTPPRVKASSINYEKTEIQPGDEQPNHFSFMSR--DEDYITDQVPCWLTYTN
TLSHDIINQNLHRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRHTEEVY
VQGLSTSLPEDVQVDLLRSIKGLENAEMMRTGYAIEYDIVLPHQLRATLETKVIAGLFTA
GQTNGTSGYEEAAGQGLVAGINAALKVQ-----GKPELILKRSDAYIGVMIDDLVTKGTL
EPYRLLTSRAEYRLILRHDNADMRLTEIGYEIGLVDEERYAIFKKRQMQFENELERLDSI
KLKP-VS-ETNKRIQELGFKPLTDALTAKEFMRRPQITYAVATDFV--GCADEP----LD
S-KVIELLETEIKYEGYIKKALDQVAKMKRMEEKRIPPHIDWDDIDSIATEARQKFKKIN
PETLGQASRISGVNPADISILMVYLEGRQKGRKNI-------------------------
---N
>gi|42519902|ref|NP_965832.1|	   632 residues, 50 /line  glucose-inhibited division protein A [Lactobacillus johnsonii NCC 533]
------------------------------------------------------------
----------------------MKTYESNEYDVIVVGAGHAGVEAALASARMGEKTLLLT
INLDMVAFMPCNPSVGGPAKGTVVREIDALGGEMGKNIDATYIQMRMLNTGKGPAVRALR
AQADKWQYHERMKDTIENE--------PNLTLRQAVADELIV-ED---------------
-GVCKGLITNTGAKYYAKSVVLTTGTAARGKIIIGELAYSSGPNNSLPSIKLPENLEKLG
FKLRRFKTGTPPRVDGNTIDYSKTQEEPGDKEPRHFSYTSK--DSDYLEDQMSCYMTYTN
TVTHDIIRANLDRAPMFSGVIKGVGPRYCPSIEDKVVRFADKDRHQIFLEPEGRHTKEIY
VGDFSTSMPEEVQLKMLHSVAGLEKAELMRPGYAIEYDVIEPWQLKHTLETKNIKHLFTA
GQMNGTSGYEEAAGQGLIAGINAALSAQ-----NKPGFTLQRDEAYIGVLIDDLVTKGTN
EPYRLLTSRAEYRLLLRHDNADLRLTEKGHELGLISEDRYKEFQDKKQAISQAMEAIKKV
TIHP-TD-EVQEYLASVKQDRLNAGVSGADFLKRPRVTFDAVERLS--GE-TLA----TD
R-YVKEQVEIALKYEGYIKKEKTLVDRLHRLESKKIPVDIDYNAIPSLATEARQKFEKIR
PESIAQAERISGVNPADLAILTAYIQQGRIAKVKN-------------------------
---K
>gi|58338214|ref|YP_194799.1|	   632 residues, 50 /line  glucose-inhibited division protein A [Lactobacillus acidophilus NCFM]
------------------------------------------------------------
---------------------MIKTYDSNEYDVIVVGAGHAGCEAALASAHMGQKTLLVT
IGLDMVAFMPCNPSVGGPAKGTVVREIDALGGQMGKNIDATYIQMRMLNTGKGPAVRALR
AQADKWQYHEYMKDTIENT--------PNLTLRQAIVDELVV-ED---------------
-GVCKGVITNTGAKYHAKSVVLTTGTAARGKIIIGELMYSSGPNNTTPSIKLSENLEKLG
FKLRRFKTGTPPRVNGNTIDYSKTEEEPGDKVPRHFSYESK--DENYLQNQISCWMTYTN
PVTHEVIRDNLDRAPMFTGVIKGVGPRYCPSIEDKVVRFADKDRHQIFLEPEGKTTKEVY
VGDFSTSMPEEVQLKMVHSVAGLEHAEMMRPGYAIEYDVVEPWQLKHTLETKNVKHLFTA
GQMNGTSGYEEAAGQGLIAGINAALSAQ-----GKSGFTLGRNDAYIGVLIDDLVTKGTN
EPYRLLTSRAEYRLILRHDNADLRLTEYGHKLGLISDDRYQAFEEKKQAIKDTQARLHEI
TVHV-TD-EVQDFLKSIGQEPMKAGVKADVFLRRPHVTINDIERLT--GQ-KID----GD
R-YVKEQVEIGIKYAGYIKKEETRIARLKRQEAKKIPADIDYNMIEGLATEARQKFEKIR
PETLAQAERISGVNPADLAILSVYIQNGRYSRVNK-------------------------
----
>gi|90961108|ref|YP_535024.1|	   637 residues, 50 /line  Putative tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase subunit [Lactobacillus salivarius subsp. salivarius UCC118]
----------M-------------------------------------------------
--------------------EFGKRYKAKDYDVIVVGAGHAGCEAALASARMGNETLLIT
INLEMVAFMPCNPSIGGPAKGIVVREIDAMGGEMGRNIDKTYVQMRMLNTGKGPAVRALR
AQADKRQYSIEMKHTIEQT--------PHLTLRQGIVDDLII-ED---------------
-GEVKGVVTNTGACYGAKSVVLTTGTAARGKIIIGELMYSSGPNNTQPALELSKNLAKLG
FELKRFKTGTPPRVDGNTIDYDKTEEQPGDVEPNHFSYESKDEDYLKVKDQLSCWLTYTN
EYTHKIIQDNLDRAPMFTGVIEGVGPRYCPSIEDKIVRFSDKPRHQLFLEPEGRNTDEYY
VQGLSTSLPEEVQQEMVRSIDGLEHAEMMRPGYAIEYDVVSPYQLRPTLETKLIKGLYTA
GQTNGTSGYEEAAGQGFIAGVNAGRRAK-----GLEEITLKRSDAYIGVMIDDLVTKGTN
EPYRLLTSRAEYRLILRHDNADLRLTELGHEIGLISDERYAAFEEKKAQIEAEKQRLSKI
RIKP-NA-EVNAFVEAHGDRELKDGVLATEFLRRPYVTYQDLLKFI--PAPAEP----LD
R-RVIEQIEIQFKYEGYIKKEYAKVEKLKRMEAKKIPARIDYSRIEGIATEAQQKLAKIQ
PETLAQAGRISGVNPADLSILAVYIEQGKIARVDD-------------------------
----
>gi|46908999|ref|YP_015388.1|	   632 residues, 50 /line  glucose-inhibited division protein A [Listeria monocytogenes str. 4b F2365]
------------------------------------------------------------
----------------------MQTYNAGTFDVIVVGAGHAGVEAGLASGRMGAKTLMLT
INLDMVAFMPCNPSVGGPAKGVVVREIDALGGEMGRNTDKTYIQMRMLNTGKGPAVRALR
AQADKWDYQHEMKHTIEKE--------ENITLRQGLVDRLVI-ED---------------
-GVCKGVITNSGAIYYAKTVVITTGTFSRGEIIVGELRYSSGPNNQQPSVKLSEHLEELG
FELRRFKTGTPPRVKSSTIDYSKTEEQPGDDHPRAFSFDT----VEMLLDQLPCWLTYTN
ETTHEIIQANLHRSPMFTATKKGTGARYCPSIEDKIVRFSDKPRHQIFLEPEGKNTEEVY
VQGLSTSLPEEVQREMLRTIPGLENVEMMRVGYAIEYDAVMPDQLWPSLETKLVEGLFTA
GQINGTSGYEEAAGQGLMAGINAARKVF-----AKEPVILGRDQAYIGVLIDDLVTKGTE
EPYRLLTSRAEYRLLLRHDNADLRLTEIGHEIGLISDERYERFLAKQSAIEAEKERLQKT
RIKP-TA-EVQAMLKEIGSGELKDGILAADLLRRPEITYDKIAQIV--SR-ETF----VT
D-EIAEQVEIQIKYEGYIQKSNLQVEKMKRMEDKKIPENIDYDAISGLATEALEKLKKIE
PLSIAQASRISGVNPADISILLVYIEQGKIAKRDKEK-----------------------
---A
>gi|15616623|ref|NP_244929.1|	   632 residues, 50 /line  glucose-inhibited division protein A [Bacillus halodurans C-125]
------------------------------------------------------------
-----------------------MSYQGGEFDVIVVGAGHAGVEAGLAAARMGANTLMLT
LNLDAVAFMPCNPSVGGPAKGIVVREIDALGGEMARNIDKTHIQMRMLNTGKGPAVRALR
AQADKFLYQHEMKKTIEEE--------ENLLLRQGMVERLII-ED---------------
-GECRGVITNTGAEYRAKAVVVTTGTYLRGKIIIGDLAYESGPNNMQPSINLSYHLQELG
FEMVRFKTGTPPRVNGETIDYDKTEIQPGDEVPRAFSYET----TKYITDQLPCWLTYTG
DKTHQIINDNLGRSPMYSGMIEGTGPRYCPSIEDKIVRFNDKPRHQIFLEPEGRHTSEVY
VQGLSTSLPEDVQLDVLKSIPGLEKARMMRPGYAIEYDAIVPTQLWPTLETKKVPGLFTA
GQINGTSGYEEAAGQGIMAGINAALRVQ-----GKDGLILDRSEAYIGVLIDDLVTKGTN
EPYRLLTSRAEYRLLLRHDNADLRLTEKGYEIGLIARERYERFCEKKAQIAAEKKRLESI
TVKP-SK-EVNALLEEVGSAPLKEAVQANVFLKRPEVTYEHVAKVI--PAPEQE----LS
A-DVAEQVEIQIKYEGYISKMLQQVERAKKMNDKKIPEDLDYDAINGLATEAKQKLSEVR
PLSVGQASRVSGVNPSDISILLVYLEQGRLAKLGKKT-----------------------
---V
>gi|20807573|ref|NP_622744.1|	   633 residues, 50 /line  glucose-inhibited division protein A [Thermoanaerobacter tengcongensis MB4]
------------------------------------------------------------
-----------------------MRFVAGEYDVCVVGLGHAGSEAALASARLGLSTVGFA
TNLDAIALMACNPSIGGPAKAQLVREIDALGGQMAINTDKSLLQMRTLNTSKGPAVRSLR
AQVDKKLYQMNMKHTLERQ--------ENLDIKQAEIVDILV-ED---------------
-NKVTGVVTKLGAIYKCKACIITTGTFLKGRVIIGEVDFESGPSGLFPASELSEALKRLG
FKLMRFKTGTPPRVDKRSIDFSKMEIQPGDEVITPFSFMH----DKIEIEQMPCWLTYTN
EKTHKIIRDNIHRAPLFTGAITGVGVRYCPSIEDKVVKFPHRERHQIFIEPEGRDTYEMY
VQGMSSSLPEDVQLEFLRTVPGLENVRVMRPAYAIEYDCIDPTQLKATLESKWIEGLYFA
GQVNGTSGYEEAAAQGLMAGINAAMKIL-----NKPPVVLDRSQAYIGILIDDLVTKGTN
EPYRMLTSRAEYRLLLRQDNADFRLTEIGKEIGLVTEERYEKFLRKKIQLEKEMRRLSTV
MVRP-TE-EVNNFLISRGSTPLVSGVDLYTLLKRPEVDYKSTKFLD--PD-RPD---DIL
D-SVAEQIDINIKYEGYILKQLRQVEQFKAMENKKIPEDIDYYQISGLSNEAKEKLSKIR
PTSVGQASRISGVSPADISVLLIYLQQMRKKKSNESRI----------------------
---S
>gi|20809124|ref|NP_624295.1|	   633 residues, 50 /line  glucose-inhibited division protein A [Thermoanaerobacter tengcongensis MB4]
------------------------------------------------------------
-----------------------MRYIAGEYDVCVVGLGHAGSEAALASARLGLATVGFA
TNLDAIALMACNPSIGGPAKAQLVREIDALGGEMAVNTDKSLLQMRTLNTSKGPAVRSLR
AQVDKKLYQANMKHTLERQ--------KNLDIKQAEIVDILV-EN---------------
-NKVVGVVTKLGAIYKCKACIITTGTFLRGRVIIGEVGFESGPSGLFPAKELSEAIKRLG
FKMMRFNTSTPPRVDKRTVDFSKMIMQPGDEVITPFSFMH----DKIEIEQIPCWLTYTN
EKTHKIIRDNIHRAPLYTGEVEGVGVRYCPSIEDKVMKFPHRDRHQIFVEPEGRDTYEMY
IQGLFSSFPEDLQMEILSTIPGLENAKIMRPAYAIEYDCIDPTQLKATLETKLVEGLYFA
GQVNGTSGYEEAAAQGLMAGINAALKIL-----GKPPLILDRSQAYIGILIDDLVTKGTN
EPYRMLTSRAEYRLILRQDNADFRLTEIGKEIGLVTEERYEKFLRKKIQLEKEMMRLPTV
MVRP-TE-EVNNFLISRGSTPLVSGVDLYTLLKRPEIDYKSTKFLD--PT-RPD---DIL
D-SVAEQIDINIKYEGYILKQLRQVEQFKAMENKKIPEDIDYYQVHGLSNEAKEKLSKIR
PTSVGQASRISGVSPADISVLLIYLQQMRRKRSDEAKI----------------------
---N
>gi|76795589|ref|ZP_00777961.1|	   633 residues, 50 /line  Glucose-inhibited division protein A subfamily [Thermoanaerobacter ethanolicus ATCC 33223]
------------------------------------------------------------
-----------------------MNFIAGEYDVAVVGLGHAGSEAALACARLGLKTVGFA
VNLDSIALMACNPSIGGPAKAQLVREIDALGGEMAINTDKSLLQIRTLNTSKGPAVRSLR
AQVDKKLYQMNMKYTLERQ--------ENLDIKQAEIVDILV-ED---------------
-NKVTGVVTKLGAIYKCKACIITTGTFLKGRVIIGDVSFDSGPSGLFPANQLSETLKRLG
FKLMRFKTGTPARVDKRSIDFSKMEIQPGDEVITPFSYMH----DKIEIEQLPCWLTYTN
KRTHEIIMANIHRSPLFSGEITGVGVRYCPSIEDKVVKFPHKERHQIFIEPEGLNTYEMY
VQGMSSSLPEDVQLEFLRTVPGLENVRVMRPAYAIEYDCIDPTQLKATLESKKIEGLYFA
GQVNGTSGYEEAAAQGLMAGINAAMKLL-----NKPSVILDRSQAYIGVLIDDLVTKGTN
EPYRMLTSRAEYRLLLRQDNADFRLTELGYKIGLVTEERYQKFLKKKIQLEKEMRRLLGV
MIKP-SE-EVNNFLISKGSTPLVTGVDLYTLLKRPEIDYKSTKFLD--KN-RPD---DIL
D-SVAEQIDINIKYEGYIMKQLRQVEHFKALENKKIPEDIDYYQIHGLSNEAKEKLTKIR
PTSIGQASRISGVSPADISVLLIYMQQLRRNKEDEEQI----------------------
---G
>gi|89210808|ref|ZP_01189192.1|	   656 residues, 50 /line  Glucose-inhibited division protein A subfamily [Halothermothrix orenii H 168]
MIGFLLIFVLVN-------------------------------------------NEDVV
VKGG------------NKMSRDFMSIYPKEYDVIVIGAGHAGSEASLAPARMGFKVLTMT
VDLDHVAFMPCNPSLGGPGKSHIVREIDALGGEMARNMDETMIQIRMLNTSKGPAVRGLR
GQADKKQYHLRMKRVLERE--------PNVDLKQEIAEKLVI-ED---------------
-GEIKGVITKTGILYRAKKVIVTTGTFLKGKIIIGEATFNAGPNQQYPANKLSESLKKAG
FKLRRFKTGTPPRVNKNSLDFSKMKEQTGDKGLT-FSFVS----PPFTREQVSCWLTYTT
DETHRIIQENKHRTPLFSGDIEGVGPRYCPSIEDKVVRFPHKDRHQIFLEPEGEFTDEYY
VAGLSSSLPEDVQIDLVRSIPGMEKAEIMRPAYAIEYDCIDPTQLKLTLEAKHIKGLYMA
GQINGTSGYEEAAGQGLIAGINASLSLQ-----GKDPLILKRSEAYIGVLIDELVTKGTN
EPYRIMTSRAEYRLILRQDNADQRLTPKGYEIGLISEERYKKFRKKVDKIEEALEFLRSN
QISP-TP-EVRERLKELNSGDLSKPVTLEQLLRRPQLEYRDLKYFV--DD-LPE----YP
D-DIIEQVSIQVKYKGYIDRQMSQIEQFKKMEDKLIPDDIDYQELENLRLEAREKLDKIK
PRSLGQASRISGVSPADISVLMVYLEQRQRRKQGEK------------------------
----
>gi|145847275|gb|EDK24193.1|	   636 residues, 50 /line  hypothetical protein RUMTOR_01651 [Ruminococcus torques ATCC 27756]
------------------------------------------------------------
----------------MKYSANSVWENKDQYDIAVVGAGHAGCEAALACARLGFKTVMFT
VSVDSIALMPCNPNIGGSSKGHLVKEIDALGGEMGKVIDKTFIQSKMLNQSKGPAVHSLR
AQADKSDYSKEMRRVLEEQ--------DNLDIRQMEVTDIIA-DDPNE----------SG
IRKIKGVQTYSGAIYPCKAVILCTGTYLKARCIYGEISTQTGPNGLQSANYLTDSLKSLG
IKMYRFKTGTPARIDKNSIDFTKMEEQKGDERVVPFSFTTD--PEDVQIDQVSCWLTYTN
ETTHEIIRENLDRSPLFSGAIEGTGPRYCPSIEDKVVKFPDKNRHQVFIEPEGIHTNEMY
VGGMSSSLPEDVQYAMYRSVPGLEHAKIVRNAYAIEYDCIDARQLKSTLEFKNIEGLFSG
GQFNGSSGYEEAAAQGIVAGINAARKLQ-----GKEGIVIDRSQGYIGVLIDDLVTKESR
EPYRMMTSRAEYRLLLRQDNADQRLTKIGYKIGLISEERYEKLLEKERLIEEEIHRVERV
NIGT-SE-EVQNLLKTYESTPLTSGTTLAELIRRPELSYEKLAPID--K-NRK----NLP
E-DVAQQVDINIKYDGYIKRQMRQVEQFKKLENKKIPEDINYDEIKSLRIEAKQKLNQIR
PASIGQASRISGVSPADVSVLLVYLGSR--------------------------------
----
>gi|149753037|gb|EDM62968.1|	   636 residues, 50 /line  hypothetical protein DORLON_01555 [Dorea longicatena DSM 13814]
------------------------------------------------------------
----------------MRYSANSVWENKDKYDVVVIGAGHAGCEAALATARLGFQTLVFT
VSVDSIAMMPCNPNIGGSSKGHLVRELDALGGEMGKVIDRTFIQSKMLNKSKGPAVHSLR
AQADKAVYSRTMRRVLEAQ--------ENLEIKQGEVANLLV-ED---------------
-GKITGVQTFSGATYHCKAVIICSGTYLKARCIYGDVSQYTGPNGLQAANHLTDCLKELG
IKMYRFKTGTPARVDRKTVDFSKMEEQFGDERVVPFSFTTN--PDDVQIDQASCWLTYTN
ETTHEIIRANLDRSPLYSGMIEGTGPRYCPSIEDKVVKFADKKRHQVFLEPEGLETDEMY
IGGMSSSLPEDVQYAMYRSVPGLEHVKIVRNAYAIEYDCIDARQLKPSLEFRNISGLFSA
GQFNGSSGYEEAAAQGLIAGINAARKLQ-----GKESLVLDRSEAYIGVLIDDLVTKESH
EPYRMMTSRAEYRLLLRQDNADQRLTEKGYEVGLISQERYDRLKEKERLIESEIERLKNA
YVGT-SE-KVQELLESYESTPLNSGSSLAELIRRPELSYEAVTAID--V-TRPELPKDLA
A-EVIEQVDISLKYDGYIQRQKRQVEQFKKMENKKIPEDMDYDAVNSLRIEAVQKLKEYR
PVSIGQASRISGVSPADISVLLVYLSGNHR------------------------------
----

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.