Fandom

Proteins Wiki

At2g13150.1/MSA

< At2g13150.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|15224966|ref|NP_178956.1|	   262 residues, 50 /line  transcription factor [Arabidopsis thaliana]
MNGSDN--S---TPS---------------------------------------------
------------------------RPRSIT-----------------------------Q
P--------------------------------------------------------SLA
FSSL--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------PPLSPS
PSSSR-RNSIPLMNPSASVESRDSS---------IRVKKKSLLPPLCVK---RRAPKDDI
EPFKRHYRSLSVDSCLSDLLKLPPSPN------------------------NVSSSRSVD
GEQNA-------------SELEFDTS------------VYTDDELNKIAKSTKLKE-VAS
DPKEVRR----------------------ILKNQESAARSKQKKLQYMINLELKINFLEN
KNASIFE-KIKLLE--------------NDKTMRMNEKKE-------IMIR---------
-IESLEQHA--EL--------------RDALTEHLH---VEIERL---------------
------------------------------------------------------------
----------------------KAVLISNEKGNE--------------------------
------------------------------------------------------------
------------------------KSPKSRDDN--------------------M
>gi|111115692|gb|ABH05132.1|	   302 residues, 50 /line  ABA responsive element binding factor 2 [Hordeum vulgare subsp. vulgare]
------------------------------------------------------------
-----------GGAGKDFGSMNMDELLRNI-----------------------------W
TAEESNAIAATLTTA---TTAVPTSNVDAQPQPPPPQQQQQAILRQGSITLPRTLSQMTV
DEVWRDIMGFCDEEP---------PPPPAPAPAQAERQQ---------------------
------TLGRMTLE-EFLVRAGVVREDM--------------------GGQTVVVPARAQ
ALFPQ---------GNVVAPTMQVGNGVV-------------------------------
------------------------------------------------------------
-----------------HGVVGQGAGVPMTV-------------------AAPTTPGVLN
GFGKM-----------EGGDLSSLS--------------PVPYPFDTVTRARKGPTVEKV
VERRQRR----------------------MIKNRESAARSRQSKQAYIMELEAEVAKLKE
NNEALQKKQVEMLQ--------------KQKDE--------------VIER---------
-IEKQLGPK----------AKRFCLR----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------RTLT--GP------------------W
>gi|119580167|gb|EAW59763.1|	   253 residues, 50 /line  X-box binding protein 1, isoform CRA_a [Homo sapiens]
MVVVAAAPNPAD------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------GTPKVLLLSGQPAS-------------
------------------------------------------------------------
------------------------------------------------------------
-----AAGAPAGQALPLMVPAQ--------------------------------------
------------------------------------------------------------
------------------RGASPEAASGGLPQARK---------------RQRLTH-LSP
EEKALRR----------------------KLKNRVAAQTARDRKKARMSELEQQVVDLEE
ENQKLLL-ENQLLR--------------EKTHGLVVENQE-------LRQR---------
-LGMDALVAEEEAE----------------------AKGNEVRPV---------------
----------------------AGSAESAA------------------------------
----------------------QVQAQLSPLQNISPWIL-----------AVLTLQIQSL
I---------------------SCWAFWTTWTQ-------------SCSSNALPQSLPAW
RSSQRSTQKDPVPYQPPFLCQWGRHQPSWKP--LM------------------N
>gi|47575714|ref|NP_001001199.1|	   252 residues, 50 /line  x-box binding protein 1 [Xenopus tropicalis]
MVVV--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------GAPKVIFIPGNQCE-------------
------------------------------------------------------------
------------------------------------------------------------
-----QVDALGSVMLPLSSPS---------------------------------------
------------------------------------------------------------
---------------------SPESVSNELPP-RK---------------RQRLTH-LTP
EEKALRR----------------------KLKNRVAAQTARDRKKARMSELEQQVVDLEM
ENEKLLL-ENQLLR--------------EKSHSLLTENQE-------LRQR---------
-LGLSTLEVKKEEE----------------LQELNQSRKDKVRPE---------------
----------------------TGSAESAALR----------------------------
----------------LCAPLQQEQAQMSPNLTVSTWIL-----------TALTLQTLSL
I---------------------SCWAFWKAWTQ-------------TCCLPMKKHSLEA-
-QMKRSTEKSLIPYPPPHLLLWGPHQPSWRP--LM------------------N
>gi|13898897|gb|AAK48906.1|	   350 residues, 50 /line  X-box binding protein [Xenopus laevis]
MVVV--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------GAPKVIFIPGNQCE-------------
------------------------------------------------------------
------------------------------------------------------------
-----QADALGSVMLPISSPS---------------------------------------
------------------------------------------------------------
---------------------GPESVSNEQPP-RK---------------RQRLTH-LSS
EEKALRR----------------------KLKNRVAAQTARDRKKARMSELEQQVIDLEM
ENEKLLI-ENQILR--------------EKSHGLLTENQE-------LRQR---------
-LGLSTLELKKEEE----------------EESQSDLLLGLLESLDSDLLLAYEGALAGS
PDEELKGEESDSISSSPSSPVGTPSAKLDAINELIRFDHVYTKPLSTEEDSAQGVETSIV
VKMEEASFSPTCEDDLTCVKQEPQEDDLVPILGMQSFLP-----------CSENNLEKSS
N---------------------ILDTGSDSGYE-------------GCSSPFSDLSSPL-
-NSDRVWEDSFSTELFPQLLLSAHMDQSICP--SSPVDAVSFWSHSSEFDVH-F
>gi|113367224|gb|ABI34669.1|	   332 residues, 50 /line  bZIP transcription factor bZIP131 [Glycine max]
MNQK--------------FIGK-P--------PATVDLD---------------------
------------------------------------------------------------
------------------------------------------------------------
--------R---MP--ERGSHHRRS--------------------HSDTSFRFAANFD--
-DLLLFDPSDFDIS-GLP-------SPLPLPSPVSAGLVPMSVDSDESGKQPR-------
--------------------------------------------------PAGASA----
------------------------------------------------------------
---GGHLRSLSVDSDFFDGLGFGVGGDERGA---------GKGGGGERRVGHHRHSNSMD
GSST--------------TSFEADSAM-------------IMDGVKKAMAPDKLAELALM
DPKRAKR----------------------ILANRQSAARSKERKIRYTSELERKVQTLQT
EATNLSA-QLTMLQ--------------RDTTDLTTENKE-------LKLR---------
-LEALEQEA--QL--------------REDLNEALK---EELQRL---------------
------------------------------------------------------------
----------------------RAQSTRLGAIGGNPSF-GGIFNQLASQ--------LAM
QQLSNSAPHQQT---------------QHQPQ---VGMPPPPSGQNHP------------
---------------------------NFMDFNQQ------------------K
>gi|8777512|dbj|BAA97100.1|	   350 residues, 50 /line  bZIP transcriptional activator RSG [Nicotiana tabacum]
MDPK--------------FSGK-PIPIPFL--AGRTDLD---------------------
------------------------------------------------------------
------------------------------------------------------------
--------QMPDTP--TRIARHRRA--------------------QSETFFRFP-DFD--
-DDILLDDVVADFNLDIS-------APSLSPSADTHMQPANSADSSSTGGPGL-------
--------------------------------------------------MSGPGA----
--------------------NNNPR-----------------------------------
--PLNHFRSLSVDADFFDGLEFGATTPGAAAEEEK---KVFGSSSVSGSGTRHRHSNSMD
GSFST-------------ASFEAE----------------CSSSVKKAMAPDRLAELALI
DPKRAKR----------------------ILANRQSAARSKERKIRYTSELERKVQTLQT
EATTLSA-QITVLQ--------------RDNSGLTNENKE-------LKLR---------
-LQALEQGA--HL--------------RDALNEALR---EELQRL---------------
------------------------------------------------------------
----------------------KIAAGQILGANGN----RGPRPHFPPQ-------PQSF
VQCGSHHAQQQQ---------------QHMPHS--TTSTQNIGGQTQP------------
---------------------------SFMNFNNR------------------G
>gi|115487474|ref|NP_001066224.1|	   328 residues, 50 /line  Os12g0162500 [Oryza sativa (japonica cultivar-group)]
MDGR--------------F----PLPPA--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------SG--GGRGHHRRA--------------------HSETFLRLP-DAD--
--LLLDPEGDFSFS-DLD-------FPSLSDDSPA------ISDPTPPPPPPM-------
--------------------------------------------------AATPAP----
--------------------APRPP-----------------------------------
--GGAHMRSLSLDTAFFEGFSLQGGGG-------------GGGGGGSGGSGGHKRSGSMD
GVNSP-------------FEGESALSG------------GLPDYAKKAMPAERIAELALI
DPKRAKR----------------------ILANRQSAARSKERKIKYTSELERKVQTLQT
EATTLSA-QLTLLQ--------------RDTSGLTAENRE-------LKLR---------
-LQSMEEQA--KL--------------RDALNEALR---EEVQRL---------------
------------------------------------------------------------
----------------------KIAAGQAPNMNGNPFN-GGLQQQIPPYYTQQQQQQQQM
PYLGGHHAQQRH--------------PSHQQSS--SNGGQSLSGQSLN------------
---------------------------DSMDFM---------------------
>gi|125576305|gb|EAZ17527.1|	   350 residues, 50 /line  hypothetical protein OsJ_031736 [Oryza sativa (japonica cultivar-group)]
MDPR--------------F----PPPAPSG------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------GA--PPRGHHRRA--------------------HSETFIRLP-DAD--
--LLLDPDGEFGFS-DLD-------FPSLSDDSPA------ASDPTPPPPPP--------
---------------------------------------------------ALPQA----
--------------------APRPP-----------------------------------
--GGAHLRSLSLDAAFFDGLAFQGGGGGG-----------GAGSGSSGGGAGHKRSGSMD
GESSL-------------FEGESAP----------------PDYAKKAMPADRLAELALL
DPKRAKR----------------------ILANRQSAARSKERKIKYTGELERKVQTLQT
EATTLST-QLTLLQLLHRTTSSSFEFKVASSSGVLGHYKA-------IEIKESKYIYPDK
QSNLLRKPS--LF--------------NAALNDALR---EEVQRL---------------
------------------------------------------------------------
----------------------KIAAGQVPNMNGNSFN-GGLQQQQQQQMPTYFSQQQQM
HYLSGHQGRHHH--------------PNNPHNS--LNGGQSMSGQTLN------------
---------------------------DSMDFM---------------------
>gi|2921823|gb|AAC04862.1|	   340 residues, 50 /line  shoot-forming PKSF1 [Paulownia kawakamii]
MNDGPEVCRK--------VRTRRPIQTGQS------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------SL--GPDARHTDP--------------------PGP------------
-------PPPGPLGDLLP-------FPYARRHPPRR----RPSWPQPRPPPNP-------
--------------------------------------------------SFPPSQ----
--------------------WAAAV-----------------------------------
--GPAQQDQRDQACVPFKDPAGRRG---LFRWAWIGRPAAGFDGGGSSPGPRHGHSNSVD
EYSSA-------------MSS------------------ELDSIAKRAMAADRLAELSLI
DPKRAKR----------------------ILANRQSAARSKERKTRYTSELERKVQTLQT
EATTLSA-QITLLQ--------------RDTTGLTTENKE-------LKMK---------
-LQAMEQQA--HL--------------RDALNEALK---DELQWL---------------
------------------------------------------------------------
----------------------KIAAGQVPGVNGNNR---GSFSQFSSQ-------PPTI
RYFGNHLAQQQQQQ-QQQQQQQQQQQPLHMPHS--SANNPRLGGQSQL------------
---------------------------SFQDFNHR------------------V
>gi|115452877|ref|NP_001050039.1|	   329 residues, 50 /line  Os03g0336200 [Oryza sativa (japonica cultivar-group)]
---------------------MQEPKHTDPAA----------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------MRGAHHRRA--------------------RSEVAFRLPD-----
-DL--------DLGGGGA-------GA-FDEIGSEDDLFSTFMDIEKISSG---------
------------------------------------------------------------
------------------------------------------------------------
-------------P----------AAAGGSDRDRA-------AETSSPPRPKHRHSSSVD
GSGFF---------AAARKDA-AASLA------------EVM-EAKKAMTPEQLSELAAI
DPKRAKR----------------------ILANRQSAARSKERKARYITELERKVQTLQT
EATTLSA-QLTLFQ--------------RDTTGLSAENAE-------LKIR---------
-LQAMEQQA--QL--------------RDALNDALK---QELERL---------------
------------------------------------------------------------
----------------------KLATGEMTNSNE-TYS-MGLQHVPY---------NTPF
FPLAQHNAARQNGGT-QLPPQFQPPRPNVPNH-M-LSHPNGLQDIMQQDPLGRLQGLDI-
----S-KGPLVVKSESSSI--------SASESSST------------------F
>gi|125559615|gb|EAZ05151.1|	   336 residues, 50 /line  hypothetical protein OsI_026383 [Oryza sativa (indica cultivar-group)]
----------------------------MPQL----------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------CTQDWIPAA--------------------APLCASTCPC-----
-RL--------DGCRLAA-------AT-VLQTAPR----SCSQDPGDRRPV---------
------------------------------------------------------------
------------------------------------------------------------
-------------P----------LGCSNLPTCYF-------CLLPCSVRRSTRRGASFD
GFAFGAGAGGPGTGLGKQQDGAGGVFS------------EVM-EAKKAMSSEQLAELAAI
DPKRAKR----------------------ILANRQSAARSKERKARYITELERKVQTLQT
EATTLSA-QLTLFQ--------------RDTTGLSAENAE-------LKIR---------
-LQAMEQQA--QL--------------RDALNDALK---QEVERL---------------
------------------------------------------------------------
----------------------KIATGEMAKSND-AYN-TGMQQVPY---------SPSF
FQLSDQHAVQHHAGVQQLPHQFQQPHPSVPSHQM-LSHPNSLSDMMQQDSLGRLQGLDI-
----G-KGPVAVKNEAEVV--------VKSEGSSI-----SAGG------EG-H
>gi|15222213|ref|NP_172170.1|	   337 residues, 50 /line  bZIP transcription factor, putative [Arabidopsis thaliana]
------------------MEKSDPPPVPKPGATIIPSSD---------------------
------------------------------------------------------------
------------------------------------------------------------
--------PIPNADPIPSSSFHRRS--------------------RSDDMSMFMF-----
--------MD-PLSSAAP-------PSS-DDLPSDDDLFSSFIDVDSLTSN---------
------------------------------------------------------------
------------------------------------------------------------
-------------PNPFQNPSLSSNSVSGAANPP----------PPPSSRPRHRHSNSVD
AGCAM-------------------YAG------------DIM-DAKKAMPPEKLSELWNI
DPKRAKR----------------------ILANRQSAARSKERKARYIQELERKVQSLQT
EATTLSA-QLTLYQ--------------RDTNGLANENTE-------LKLR---------
-LQAMEQQA--QL--------------RNALNEALR---KEVERM---------------
------------------------------------------------------------
----------------------KMETGEISGNSD-SFD-MGMQQIQY---------SSST
FMAIPPY----HGSM-NLH-DMQMHSSFNP---MEMSNSQSVSDFLQN---GRMQGLEI-
----SSNSSSLVKSEGPSL--------SASESSSA------------------Y
>gi|92898302|gb|ABE94130.1|	   358 residues, 50 /line  cAMP response element binding (CREB) protein [Medicago truncatula]
MQHQSSNPNPNSNPNRHNASQLPPPPPPSTAAATTAKPS---------------------
------------------------------------------------------------
------------------------------------------------------------
--------LFPRTTNV--PSHHRRA--------------------HSDLTFRLPD-----
-DMMDLSPSD-PFTGGSS-------TASLDEIGSEDDLFSTYIDMDKLGDG---------
------------------------------------------------------------
------------------------------------------------------------
-----------------------GADPGGNDEG-----------EKNPVRSRHRHSNSVD
GSSSF---------------------G------------EIM-DGKKAMPPDKLAELWSV
DPKRAKR----------------------ILANRQSAARSKERKARYIHELERKVQTLQT
EATTLSA-QLTLYQ--------------RDTTGLSTENTE-------LKLR---------
-LQAMEQQA--HL--------------RDALNDALK---KEVERL---------------
------------------------------------------------------------
----------------------KVATGDIMSHTE-SFN-LGMHQMQF---------TESD
YAPIPPQGPSGHRNI-RLP-LFGHSPSSMPSHQLHQTNSHSYSELLQNDQIGRFQGLDI-
----SSKGTAVVKSEDPSL--------SASESSTT------------------F
>gi|113367276|gb|ABI34695.1|	   330 residues, 50 /line  bZIP transcription factor bZIP21 [Glycine max]
LVKRETPWD---RGVENNNNNNVE------GSGEKKSPEGEVVDDLFSAY----------
-----------------------------MNLDSFDALNSSGTDDKNGGENRDDLD----
------SRASGTKTNGGDSSDNEAESSVNESGDGGVRQGGNE------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------KREGMKRSAGGEI
APTTRHYRSVSMDSFI-GKLNFDEESPKL-----------PP--SPGQRSALMSPAGGID
GNSAA-------------FSLE-FGNG-----------EFSGPELKKIMANEKLAEIALI
DPKRAKR----------------------ILANRQSAARSKERKMRYISELEHKVQTLQT
EATTLSA-QLTLLQ--------------RDSAGLTNQNSE-------LKFR---------
-LQSMEQQA--KL--------------RDALNEALT---AEVQRL---------------
------------------------------------------------------------
----------------------KLATAELSGDSHGS---GCLIPQHSVNPLMF-------
--------QQ-----QQQPPTAS-------------------------------------
----------------------------------Q------------------Q
>gi|115440013|ref|NP_001044286.1|	   265 residues, 50 /line  Os01g0756200 [Oryza sativa (japonica cultivar-group)]
------------------MAQLPP------KIPV-------------AAPG---------
------------------HHQHWASAGGAG-----------------------------D
A--------------------------------------------------------AWA
DEFA----EFAASR-R---GAHRRS--------------------LSDSVAFVE-VAP--
--------AGC------------GAGGEFDRL-DDDQLMSMFPDEG--------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------GSSAPGSDNGGSDSDGGGDK
HAA------------AQSDDGQ-HAA---------------GEP-TQEQAAATSPTELIR
DPKRVKR----------------------ILANRQSAQRSRVRKLQYISELERSVTTLQN
EVSVLSP-RVAFLD--------------QQRTILTVGNSH-------LKQR---------
-IAALAQDK--IF--------------KDAHQEALR---KEIERL---------------
------------------------------------------------------------
----------------------RQVYQQQNTKLSGG-LA---------------------
---------------------------ADHAHV-------------HG---GP--P----
------------------PVRAEKELM--------------------------S
>gi|125569494|gb|EAZ11009.1|	   279 residues, 50 /line  hypothetical protein OsJ_000834 [Oryza sativa (japonica cultivar-group)]
------------------MAQLPP------KIPT-------------MATAWPEFGGGH-
HHH-----------AAHGHHHQRSPSMGAFLAAPLPPFPLPPPAPANGGAQQQQQQQQHQ
P--------------------------------------------------------SWV
DEFL----DFSATK-R---GAHRRS--------------------QQPAAPA--------
---------------------------------------------A--------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------SASSPSDHNSMND-------
---------------EKQDKGE-TDE---------------AQSECDGATPGQPASPATV
DPKRVKR----------------------ILANRQSAQRSRVRKLQYISELERSVTSLQT
EVSALSP-RVAFLD--------------HQRSLLTLGNSH-------LKQR---------
-IAALAQDK--IF--------------KDAHQEALK---KEIERL---------------
------------------------------------------------------------
----------------------RQIYHQQSLKNAES-QP---------------------
---------------------------ADAAPV-------------RG---RDNAD----
------------------LIGSEGAAAAAPCPH--------------------S
>gi|125581476|gb|EAZ22407.1|	   269 residues, 50 /line  hypothetical protein OsJ_005890 [Oryza sativa (japonica cultivar-group)]
------------------MAQLPP------RAPS-------------AAAA---------
------------------AGQEWSAM----------------------------------
---------------------------------------------------------AAA
GEFL----GFAAAR-R---GAHRRS--------------------ASDSAAFLM-EAAVP
MDD---VIVGV------------GGGGEFDRL-DDEQLMSMFSDVE--------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------APAVSDGGGERGPAGEA
HLMDM----GD----GDDGMGA-TSP---------------AGAGAMAAAAAGGAADGIA
DPKRVKR----------------------ILANRQSAQRSRVRKLQYISELERSVTTLQM
EVSALSP-RVAFLD--------------HQRSLLTVGNSH-------LKQR---------
-IAALAQDK--IF--------------KDAHQEALK---KEIERL---------------
------------------------------------------------------------
----------------------RQVYHQQQIKATGGADI---------------------
---------------------------ATAASM-------------QA---KH--E----
------------------LLACEGAAM--------------------------R
>gi|147768650|emb|CAN71664.1|	   294 residues, 50 /line  hypothetical protein [Vitis vinifera]
-------------------MAAPA------LLPA-------------ATAT---------
--------------------------TTSQ-----------------------------H
P--------------------------------------------------------SWV
DEFL----DFSSSR-R---GSHRRS--------------------VSDSIAFLE-APVLV
EEARHSHATML------------HGANGFDRL-DDDQLMSMFSDDISLTVPPT-------
------------------------------------------------------------
------------------------------------------------------------
-------------------------VSSS-----------GPSTPSDQNSNND--EKGDE
KGAAL----DQQPPKNEPGEVE-SSC---------------KTELPSFRPSTASNGDSII
DPKRVKR----------------------ILANRQSAQRSRVRKLQYISELERSVTSLQT
EVSALSP-RVAFLD--------------HQRLILNVDNSA-------LKQR---------
-IAALAQDK--IF--------------KDAHQEALK---KEIERL---------------
------------------------------------------------------------
----------------------RQVYHQQSLKKMGN-SA---------------------
---------------------------TGAPPQ-------------ST---TQPHQ----
------------------TTTTDAAMGCTDKLQLL------------------N
>gi|18491297|gb|AAL69473.1|	   311 residues, 50 /line  At2g42380/MHK10.10 [Arabidopsis thaliana]
-----------------------------------------------MTQHWPDFSSQK-
LSPF----------STPTATAVATATTTVQ-----------------------------N
P--------------------------------------------------------SWV
DEFL----DFSASR-R---GNHRRS--------------------ISDSIAFLE-APTVS
IED-----------------------HQFDRF-DDEQFMSMFTDDDNLHSNPSHINN---
--------------------------------------KNNNVGP---------------
------------------------------------------------------------
------------------------TGSSS-----------NTSTPSNSFNDDNKELPPSD
HN--M----NNNINNNYNDEVQ-SQC-------KMEP----EDGTASNNNSGDSSGNRIL
DPKRVKR----------------------ILANRQSAQRSRVRKLQYISELERSVTSLQA
EVSVLSP-RVAFLD--------------HQRLLLNVDNSA-------LKQR---------
-IAALSQDK--LF--------------KDAHQEALK---REIERL---------------
------------------------------------------------------------
----------------------RQVYNQQSLTNVENA-N---------------------
---------------------------HLSATG-------------AG---ATPAV----
------------------DIKSSVETEQLLN---V------------------S
>gi|92871553|gb|ABE80500.1|	   328 residues, 50 /line  Basic-leucine zipper (bZIP) transcription factor [Medicago truncatula]
------------------MAQLPP------KVPIPN-----------MTPTWPEFSSHQK
MPNL----------KTISPSNASNFSNNQQ-----------------------------N
P--------------------------------------------------------SWV
DEFL----DFSSTR-R---GAHRRS--------------------ASDSVTFIE-ASMME
------HCRRR------------DGDNEFERF-DDEQLMSMFSVDEVS-----RNNT---
--------------------------------------MMPPPAT---------------
------------------------------------------------------------
------------------------LSSNS-----------NPSTPSDHNSIND--EKEED
EEEKM----QQKQLKHESDEDEIGEC-------KQENGGVVNDEDDNNGNTTTFSSPKIT
DPKRVKR----------------------ILANRQSAQRSRVRKLQYISELERSVTSLQA
EVSVLSP-RVAYLD--------------HQRLLLNVDNSA-------IKQR---------
-IAALAQDK--IF--------------KDAHQEALK---REIERL---------------
------------------------------------------------------------
----------------------RQVYHQQQNIKNNATAA---------------------
---------------------------AVSPSP-------------SPKPRCDNDT----
------------------HIENEHL--------IN------------------V
>gi|115441173|ref|NP_001044866.1|	   323 residues, 50 /line  Os01g0859300 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
-------------------SMNMDEFVANI-----------------------------W
NAEEFQATTGGCKGAM-------EEAKVVDSGSGSGDAGGSGLCRQGSFSLPLPLCQKTV
EEVWTEINQAPAHT-SAPASALQPHAGS-GGVAANDRQV---------------------
------TLGEMTLE-DFLVKAGVVRGSF--------------TGQAAMGSGMVNGPVNPM
QQGQGGPMMFPVGPVNAMYPVMGDGMGYPGGYNGMAIVPPPPP-------AQGAMV----
------------------------------------------------------------
----------------------------------------------------VVSPGSSD
GMSAM----THADMMNC---IGNGMMIENGTRKRPH-------------REDGCA--EKT
VERRQRR----------------------MIKNRESAARSRARKQAYTVELEAELNYLKQ
ENARLKEAEKTVLL--------------TKKQMLVEKMMEQ------SKEK---------
-MNANRGGS--QLR----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------RSGS--CM------------------W
>gi|115444913|ref|NP_001046236.1|	   360 residues, 50 /line  Os02g0203000 [Oryza sativa (japonica cultivar-group)]
-------------MATTRASLTDP------LLPSPAARAPVKAKKLSWSMLH--------
------------------------------------------------------------
------------------------------------------------------------
-----------------ASSKDERRGQSGEAEAE--------------------------
------------------------------------------------------------
------------------------------------------------------------
--------ASGGVHANPSSPARMQEQATSSRPSSSERSSSSGGHHMEIKEGKEAPLRSLL
LPFLDFHFTVPLSGMESDEE------------------------IGRVPELG--------
LEPGG------------ASTSGRAAGGGGGGAERAQS------STAQASARRRGRSPADK
EHKRLKR----------------------LLRNRVSAQQARERKKAYLNDLEVKVKDLEK
KNSELEE-RFSTLQ--------------NENQMLRQILKNT-----TVSRR---------
-GPVLL--K--IP--------------KSGLREAAP---AGCGGL---------------
------------------------------------------------------------
----------------------REAEGDEKFVLN-----GFTAANLSFDGMATVTPN---
------GLLM-----LTNGTNQLKGHAFFPALL-------------QFHRTPNSMAMQS-
----F-STAFVIGIISAFEDQGSGSPAAAGGSGRA------------------A
>gi|115446551|ref|NP_001047055.1|	   326 residues, 50 /line  Os02g0538900 [Oryza sativa (japonica cultivar-group)]
MSR---------------SPHLPP------RCPPLG------------------------
--PQITRRDDSL--FTQSCRFPSEDPFVGE-----------------------------P
P--------------------------------------------------------CWL
DDLL----ADSGKS--HTLPPLRRA--------------------CSDSDAILD-VL-TS
FQSPIYPIDE--------------------------------------------------
------------------------------------------------------------
--------------GDPQPVGEAGE---------SFNAAAEGGGSGAGI---EG------
-------------------------SCVY-----------GPNSPRQKTRLTSSESSMVN
AVLEN----VPSNPLQYLMIDATSGVNCNVGAANGT------------------------
----------------GDTGDAVCHADQEKSLKRRSGQRSRVRKLQYIADLERTVDSLQN
IGADLAV-RVASLF--------------QLRNALSMENKQ-------LRRQ---------
-ITSLQQAK--LI--------------KDGQTQMLK---KETERL---------------
------------------------------------------------------------
----------------------KQLSVRHRRSRSVTSCF---------------------
----------------------------EANSF-------------GGGDPSAINWQML-
----D-MSKLSLN--------GGAVVPPRGGY--G------------------M
>gi|115474165|ref|NP_001060681.1|	   274 residues, 50 /line  Os07g0686100 [Oryza sativa (japonica cultivar-group)]
MGVHAMSCH---GGG----GGGGE------GA---------------LSRQGSVYSLTL-
-------NEVESHLGEPLRSMNLDDLLRTV-----------------------------L
PAAAAAAETA---------------------------------------------GRKTV
DEVWRDIQG---------------------ASTGRHHAT---------------------
------PMGEMTLE-DFLSRAGVAVDGAA-------------------S-----------
------------AAGAHWLR---------------GHYPPPPP-------PTTTTL----
------------------------------------------------------------
--------------------------------------------QYVGGSGAVVDGVYN-
RVDGH-------------GVAGFLSQVGVAGRKRGG-------------GVDGVV--EKT
VERRQKR----------------------MIKNRESAARSRARKQAYTNELENKISRLEE
ENQRLRE-HKAVAD--------------FSTFPSCV------------------------
----------------------------DFLKAFLT---QKLEPV---------------
------------------------------------------------------------
----------------------MQIV--------------------------PQPEPKQQ
LR----------------------------------------------------------
---------------------------RTTS--AS------------------F
>gi|20161468|dbj|BAB90392.1|	   310 residues, 50 /line  putative promoter-binding factor-like protein [Oryza sativa (japonica cultivar-group)]
---MASKAG---GGGVARRGGGRM------RS---------------LGRQGSMYSLTL-
-------DEVQSQLGEPLHSMNLDELLRSV-----------------------------F
PDGLAIADGAGATTSS------------------QQHQPGSGLLRQGSITMPPELSKKTV
DEVWKGIQAAPKRN-A------ETGGGGGGGRRRRERQP---------------------
------TLGEVTLE-DFLVKAGVVTQGSL-------------------KELSDVGNVDPV
GRGVTATGTVDLAPGSHWIEQYKQ-----QIASTDAHHHGQQGVQGAYFPNRLVPQ----
------------------------------------------------------------
--------------------------------------------PLNVGPGAILEPSYSD
GQTSS-------------GMIGGMSDSQTPGRKRGM-------------SGD-VA--DKL
MERRQKR----------------------MIKNRESAARSRARKQAYTNELENKVSRLEE
ENVRLKR-QKE-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------
>gi|125532749|gb|EAY79314.1|	   278 residues, 50 /line  hypothetical protein OsI_033273 [Oryza sativa (indica cultivar-group)]
MEAGGGW--------------ALP------GCGGAGDVDLLNAYMSLEG-----------
------------------------------------------------------------
M--------------------------------------------------------GGA
DGLNNSD------G-DSRGSSMRTN--------------------GADSSENES------
--------EDYVGA-DSQALLWG-------------------------------------
------------------------------------------------------------
---------------------------------------GAGGGEAAGK---KRRNNAAG
ETAARHARSLSMDSLMGKL-----------------------------------------
----------------------------------------------SFAANGEPAKFSL-
-EFGSGE----------------------VLANRQSAARSKERRMRYIAELEQKVQILQT
EATTLSA-QLTLLQ--------------RDSSGMATQNNE-------LKFR---------
-LQSMEQQA--QL--------------RDALNEALT---AEVQRL---------------
------------------------------------------------------------
----------------------KLAANEVGDTSSS----SNLAHQIQLRC----------
------QNQM-----LDLHKQQQQQVEQIPFY----------------------QLEQP-
----E-QQNGTAR------------------NHES------------------K
>gi|125562411|gb|EAZ07859.1|	   320 residues, 50 /line  hypothetical protein OsI_029091 [Oryza sativa (indica cultivar-group)]
MDDPGAADP------GARPHHLSP------GQPPVVPRS---------------------
------------------------------------------------------------
------------------------------------------------------------
------------------PTPLDLSSAAAAAAAASYRRLSPSLRPPAHPQA---------
------------------------------------------------------------
------------------------------------RLPSPYPQI-----PSSSSA----
--------------------AAAGS---------SGHHARSLSQPLFF------------
SLDSLPPLPLSVDS-FIEKLNFDESPKLP-----------LP---SPSGGLSRSGSGSLD
GGAAS-------------LFGAEFANG-----------EFTEAEKKKIMANERLAEIALT
DPKRVKR----------------------ILANRQSAARSKERKMRYIQELEHKVQVLQT
EATTLSA-QLTMLQ--------------RDSTGLATQNNE-------LKIR---------
-LQAMEQQA--QL--------------RDALNEALT---AEVQRL---------------
------------------------------------------------------------
----------------------KLATGEITDGRMS----KGLQQQMNSQLI---------
--------QL-----QQLQIQQQQSSQT--------------------------------
------------------TQQGQQQQPQKS-----------------------A
>gi|125576613|gb|EAZ17835.1|	   248 residues, 50 /line  hypothetical protein OsJ_032044 [Oryza sativa (japonica cultivar-group)]
MGGGGGGGQ---AA---------------------------------PWGGVQEYYAKPS
SFGRHQG-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------RPW
EQGMNN----------------------------LVNYRQSGGPPMPAK---EKVGGHHG
SPSVLRDHDHGMDRRSS-------------------------------------------
---------------------DESGHDQKVGPERKE------------GVPPKHAQ-SEA
DTKRAK---------------------------QQYAQRSRVRKLQYIAELERKVQALQS
EGIDVSA-EMEFLS--------------QQNIMLDLENKA-------LKQR---------
-LESLAQEQ--LI--------------KRFQQEMFE---REIGRL---------------
------------------------------------------------------------
----------------------RSLYQQQQQQ-------------------QKQPQPTTT
LSRSN-------------------------------------------SRDLDS------
----Q-FANLSLKHKDPNSGPL----RTQSS--SI------------------L
>gi|125606331|gb|EAZ45367.1|	   315 residues, 50 /line  hypothetical protein OsJ_028850 [Oryza sativa (japonica cultivar-group)]
-----------------------------------------------------MFLDLEK
LNSTFRASSEA-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EADSSSAGAAAAVA---AADDNNAH
GARPKHQHSLSMDESMSIKAEELVGASPG-------------------------------
------------------------------------TEGMSSAEAKKAVSAAKLAELALV
DPQEGEKQMLHCLCEFLVGGDYYLREETLIWANRQSAARSKERKMRYIAELERKVQTLQT
EATTLSA-QLALLQ--------------RDTSGLTTENSE-------LKLR---------
-LQTMEQQV--HL--------------QDALNDTLK---SEVQRL---------------
------------------------------------------------------------
----------------------KVATGQMANGGGMMMNFGGMPHQFGGNQQMFQNNQAMQ
SMLAAHQLQQ-----LQLHPQAQQQQVLHPQHQ-------------QQQPLHPLQAQQL-
----Q-QAARDLKMKSPMGGQSQWGDGKSGS--SG------------------N
>gi|15224123|ref|NP_180011.1|	   322 residues, 50 /line  transcription factor [Arabidopsis thaliana]
MTISYPAKE---FLQTIFKTPYLK------NLYLSPTMSIYDTLIGSPATTLKRYLLKSD
VAVMYTSPSTYVENEDSSFRFNQNC---SP-----------------------------M
P--------------------------------------------------------PWV
LGTKSKTIINTLPP-K---KSHKRT--------------------NTDIIGIHS-MTSQN
SSGSSY-----------FQLLDLLADLGELIY-DDEAMKGFYYEFMNLDNKNAFNNDENL
NNLMITFTNLGGASNANES-----------------------------------------
--------------------------------------GLKIGATTSGV---KTKVDEDI
EPLCRHYKCATMDSSFIHWITHW-------------------------------------
--------------------------------------NLLDQVFSSNFV---GEGEYYT
DPNEVKR----------------------ILENRDLDTRSKQGKSLYIVDLEGSVRIHVM
VNTSLYG-MIVLLE--------------VRHITLAKKKND-------VDDE---------
-REQENE-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------DS------------------S
>gi|15235683|ref|NP_195487.1|	   305 residues, 50 /line  bZIP transcription factor family protein [Arabidopsis thaliana]
MTQKLFI-Q---Y----------------------------------SLRSYIVFWKYDQ
ITPW----------FVHKYQAPTMQFFPFP-----------------------------L
L--------------------------------------------------------ISL
ISLLEKLL----------------------------------------------------
------------------------------------------------------------
-------------------AIMLS-----TAPAFSFSEPGLVNQF-----SGFQTGFTPW
EWDCSDLFFVDQMSLEPAIPSPC-------------------------------------
--YGESDTGSVKINSGSHDMKTGSDESCA-----------GFVKINPRCDDADISNDLPC
SQADE-------------PDSDDTKQLTAI-------TNFGSGEN--NHNRKKMIQPEMT
DERKRKR----------------------MESNRESAKRSRMRKQSHIDNLREQVNRLDL
ENRELGN-RLRLVL--------------HQLQRVNSDNNRLVTEQEILRLR---------
-LSEMRRIL--II--------------RQLQQQ-QQ---WELHNR---------------
------------------------------------------------------------
----------------------RMIMTE--------------------------------
------------------------------------------------------------
-----------------------QNHPHL------------------------Q
>gi|18397171|ref|NP_565355.1|	   264 residues, 50 /line  DNA binding / transcription factor [Arabidopsis thaliana]
MNGSDNI-T---TPS---------------------------------------------
------------------------GSRSMT-----------------------------Q
P--------------------------------------------------------SLA
SSSL--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------PPLSPS
SSTFR-RNSLPSMSFSPSAPVE--------------------------------------
---SRDSSIKVNKNPSLPPLVDGEEDASW-----------LEF------GSSDYTDDEL-
------------------------------------NKIAKSTKLQDIAKSTKLQE-IVS
DPKKVRR----------------------ILKNRELAASSKQRKLKYMIDLEHRIKFLEN
KNALIFE-KIKLLE--------------KDKTILMNEKKE-------ITIQ---------
-IESLEQQA--QL--------------RDALTEKLH---VEIERL---------------
------------------------------------------------------------
----------------------KVITISNEKGSVELQRL-----------KMETCEVLQY
RREFDRS-----------------------------------------------------
----------NMQGMDPN--MFTWSQPNLGFYGQ-------------------I
>gi|18400998|ref|NP_564486.1|	   341 residues, 50 /line  VIP1 (VIRE2-INTERACTING PROTEIN 1); transcription factor [Arabidopsis thaliana]
MEGGGRG----------------P------NQTILSEIE---------------------
------------------------------------------------------------
------------------------------------------------------------
--------HMPEAP-RQRISHHRRA--------------------RSETFFSGE-SID--
-DLLLFDPSDIDFS-SLD------------------------------------------
-----------------------------------FLNAPPPPQQ-----SQQQPQASPM
SVDSEETSSNGVVPPNSLPPKPEAR-----------------------------------
--FGRHVRSFSVDSDFFDDLGVTEEKFIA-----------TSSGEKKKGNHHHSRSNSMD
GEMSS-------------ASFNIESILAS-------VSGKDSGKKNMGMGGDRLAELALL
DPKRAKR----------------------ILANRQSAARSKERKIRYTGELERKVQTLQN
EATTLSA-QVTMLQ--------------RGTSELNTENKH-------LKMR---------
-LQALEQQA--EL--------------RDALNEALR---DELNRL---------------
------------------------------------------------------------
----------------------KVVAGEIPQGNGNSYNR-----------AQFSSQQSAM
NQFGNKTN----------------------------------------------------
---------------QQMSTNGQPSLPSYMDFTKR------------------G
>gi|18420842|ref|NP_568457.1|	   277 residues, 50 /line  BZO2H2 (basic leucine zipper O2 homolog 2); DNA binding / transcription factor [Arabidopsis thaliana]
MDNHTAK-D---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------IGMKRS--------------------ASELALQEY-LTTSP
LDPCF-------------------------------------------------------
------------DLMNRDYTCELR-----DSLLWSEGLFPAGPFR-----DAQSSI----
-----CE------NLSADSPVSANK-----------------------------------
--------------------------------------------PEVRGGVRRTTSG---
--SSH-------------VNSDDEDAETE-------------------AGQSEMTN-DPN
DLKRIRR----------------------MNSNRESAKRSRRRKQEYLVDLETQVDSLKG
DNSTLYK-QLIDAT--------------QQFRSAGTNNRV-------LKSD---------
-VETLRVKV--KLAEDL--------VARGSLTSSLN---QLLQTH---------------
------------------------------------------------------------
----------------------L---------------------------SPPSHSISSL
HYTGN-----------------------TSPAI-------------TVHSD----QSLF-
----P-GMTLSGQNSSPGLGNVSSEAVSCVS-DIW------------------P
>gi|28317383|tpe|CAD29861.1|	   234 residues, 50 /line  TPA: putative basic leucine zipper transcription factor [Arabidopsis thaliana]
MLSSAKH-N---KINNHSAFSISS------SSSSLSTSSSLGHNKSQ-------------
------------------------------------------------------------
---------------------------------------------------------VTM
EEVWKEIN---------------------LGSLHYHRQLNIG------------------
------------------------------------------------------------
----HEPMLKNQNPNNSIFQDFLN-----MPL----NQPPPPPPP-----PSSSTI----
-----VTALYGSLPLPPPATVLSLN-----------------------------------
--------------------------------------------SGVGFEFLDTTENL--
LASNP-------------RSFEESAKFGCLGKKRGQDSD------------------DTR
GDRRYKR----------------------MIKNRESAARSRARKQAYTNELELEIAHLQT
ENARLKI-QQEQLK--------------I-------------------------------
---------------------------AEATQNQVK---KTLQRS---------------
------------------------------------------------------------
----------------------STA-----------------------------------
------------------------------------------------------------
----------------------------------P------------------F
>gi|2934884|gb|AAC05017.1|	   326 residues, 50 /line  TGACG-motif binding factor [Glycine max]
MERSGGM-V---TGSHERNELVRV------RHGSDSGSKPLKNLNGQICQICGDTIGLTA
TGDLFVACHECGFPLCHSCYEYELKNVSQS-----------------------------C
P--------------------------------------------------------QCK
TTFTSRQE----------------------------------------------------
--GAEVEGDDDDED-DADDLDNGINYGQGNNS-KSGMLWEEDADLSSS---------SGH
DSHIPNPHLVNGQPMSGEFPCATS-----DAQ------SMQTTSD-----PMGQSE----
-----KVHSLPYADPKQPGPESDEE-----------------------------------
--------------------------------------------IRRVPEIG--------
GESAG-------------TSASRPDAGSNAGTERAQGT------G--DSQKKRGRSPADK
ESKRLKR----------------------LLRNRVSAQQARERKKAYLIDLETRVKDLEK
KNSELKE-RLSTLQ--------------NE-------NQM-------LRQI---------
-LKNTTASRRG-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------SNSGTN--NA------------------V
>gi|7638404|gb|AAF65459.1|AF245484_1	   217 residues, 50 /line  OSE2 [Oryza sativa]
-----------------MPTPALP------LVGGDRPMS-------------------PL
PAPDVAAAPR--------------------------------------------------
----------------------------------------------------------TA
EEVWKEIT---------------------GAGVAAAAGVGLPPAAAAAAAPAVV-AGA--
---GAGTGAEMTLE-DFLAREGAVK---------------------------------ED
EAVVTDPSAAKGQVVMG-------------------------------------------
------------------------------------------------------------
----------------------------------------------FLNG-A--------
EVTGG-------------VTGGRSRKRHLMDPM------------------------DRA
AMQRQKR----------------------MIKNRESAARSRERKQAYIAELESLVTQLEE
ENAKMFK-EQEEQH----------------------------------QKR---------
-LKELKE---MVVPVIIRKTSARDLR----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------RTNS--ME------------------W
>gi|83816991|ref|NP_001033032.1|	   261 residues, 50 /line  X-box binding protein 1 [Takifugu rubripes]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------MVVVTAGTGGAHKVLLISGKQSG-------------
------------------------------------------------------------
------------------------------------------------------------
--------SSGGSQPGFSRPI---------------------------------------
----------------------------------------------SVVL-P--------
SATSH-------------TSSDSDSNSSAGPPVRK---------------RQRLTH-LSP
EEKALRR----------------------KLKNRVAAQTARDRKKAKMGELEQQVLELEM
ENQKLHI-ENRLLQ--------------EKTSGLLAENEE-------LRQR---------
-LSLDTIDSKDEVQCLLSTGKEAGLGVGSSESAALR---LRVPPQ---------------
------------------------------------------------------------
----------------------QVQAQQLLNLKTSQWIQ-----------AVLILQTLSL
I---------------------CFWAFWTSLTQ-------------SCSSDLVSRSRRC-
----S-WSEGGTQYLPPHLRLWGPHQLSWRP--LM------------------N
>gi|92889087|gb|ABE89685.1|	   359 residues, 50 /line  Eukaryotic transcription factor, DNA-binding [Medicago truncatula]
--------M---YPGRHAHALLPP------KSPFPS-----------TSQAYADYVSNPT
VGPKPVNKPREG--NSHHQRTSSESHLIEE-----------------------------Q
P--------------------------------------------------------SWL
DDLL----NEPDTP-V-RRGGHRRS--------------------SSDSFAYID-NI-NA
SNINYADHDEYKYK-NLSIPAWSPPD--FDRN-KDARHVPMYAEINAA---------KQR
NRSWDSFSNMSGV--PS-------------------------------------------
-----GKDNVAFQRSGSPTPCTLYE-----------------------------------
--------------------------------------------PDRILL-T--------
ANENH-------------DSLEAGVQDTKSPFEKK-------------DGLHAKSSASET
DSKR---------------------------AKQQFAQRSRVRKLQYIAELERN-----A
EGSEVSA-ELEFLN--------------QQNLILSMENKA-------LKQR---------
-LESLAQEQ--LI--------------KYLEQEVLE---REIGRL---------------
------------------------------------------------------------
----------------------RGMYQQHLQQ------A-----------QQPQQQPSGS
HRRTN-------------------------------------------SRDLDS------
----Q-FANLSLKHKDTN----SGHDPANGA--LR------------------I
>gi|9758459|dbj|BAB08988.1|	   342 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
---------------MSRPAPLPP------RCPIPKKLS--------LSPVADTFYSSS-
-------SPIES--YIGQYKSSTQDSRLED-----------------------------Q
P--------------------------------------------------------AWL
DELLCDKTDGLLTR-G---GPLRRS--------------------ASDSVVLLG-DIS--
-------ATFS--------------G--FDQS-EDEESLSSEACGDLE---------SAC
VYGPNSPRAKNNSSFSN-------------------------------------------
-----NPIASAFSDYGSQTPPQNLD-----------------------------------
--------------------------------------------DTVKG-----------
INRSP-------------VAENACGSMGIPNAKRSRYIGFWFLVG--ILMTTKLAEIC-V
CVHKSAL----------------------RMPIRNPGQRSRVRKLQYIAELERTVGMLQT
VEADLSV-RVASLL--------------QTRATLSLENSQ-------LKQQ---------
-MAILKQDK--LI--------------REGEYQLLK---KEAQRL---------------
------------------------------------------------------------
----------------------KSGLGYLGSTNNSNRLV---------------------
-------R--------------SYSAGSNVAPR-------------TASSHLDWNL--L-
----D-LTKLNL-----------------------------------------N
>gi|125589570|gb|EAZ29920.1|	   252 residues, 50 /line  hypothetical protein OsJ_013403 [Oryza sativa (japonica cultivar-group)]
----------------MEGEPSCR------L-----------------------------
--------------SLLDRCGDGSENPVVP-----------------------------P
R--------------------------------------------------------VP-
----------------------SILNLASHKCLDQSKFLPLIHPAPAHFTSSTV-SALSP
CSEPPLSASMR--------------Q--M-------------------------------
------------------------------------------------------------
------VVKASPL--PNVKFTEDDK-----------------------------------
--------------------------------------------K---------------
---KV-------------VADKFLSEIVLTDPR------------------RDPEQS--I
ICRKVK---------------------------GEKDEVYRGASTQILGVAVGDCYIMST
SGNDAGM-LLEGV---------------RNNNGLVSLNNE-------LKTR---------
-LQAMDQQA--QW--------------GDALTARLT---AEAEHP---------------
------------------------------------------------------------
----------------------RVVVGEISDPHVPSGSH-----------QQQSSYMDKL
QQLLTQRQ----------------------------------------------------
------------------PSQTQQNQP--------------------------Q
>gi|21592919|gb|AAM64869.1|	   273 residues, 50 /line  unknown [Arabidopsis thaliana]
----------------MENNISPP------N-----------------------------
--------------NMHHHSASLDDLFTED-----------------------------Q
P--------------------------------------------------------AWL
DELL----SEPASP-K-INKGHRRS--------------------ASDTAAYLN-SALMP
SKENHVAGSSW--------------Q--FQNY-DLWQS------NSYE----------QH
NKLGWDFSTANGTNIQR-------------------------------------------
-----NMSCGALN--MSSKPIEKHV-----------------------------------
--------------------------------------------S---------------
---KM-------------KEGTSTKP-------------------------DGPGSK--T
DSKRIK---------------------------HQNAHRARLRRLEYISDLERTIQVLQV
EGCEMSS-AIHYLD--------------QQLLMLSMENRA-------LKQR---------
-MDSLAEIQ--KL--------------KHVEQQLLE---REIGNL---------------
------------------------------------------------------------
----------------------QFRRHQQQP-------------------QQNQKQVQAI
QNRYNKYQ----------------------------------------------------
------------------PPVTQEPDAQFAA--LA------------------I
>gi|92896843|gb|ABE93371.1|	   308 residues, 50 /line  cAMP response element binding (CREB) protein [Medicago truncatula]
-----------------MATTESD------------------------------------
------------------------------------------------------------
-----------------------------------------------------------L
DEFL----NLDYEF-R-YPSLADTEAFMTGVCSAAFQTLLLPDVVSSFSTWWWT-NKLPK
LYSQTLHHHCF--------------S--VIYL-WHCLT------FWIE---------LIA
YGAVGSPVSANKPNSRE-------------------------------------------
-----NHIKGTAS--GSSDPSDEDN-----------------------------------
--------------------------------------------E---------------
----------------------SGPC-------------------------EQITNP--V
DMKRQRR----------------------KDSNCESARRSRWRKQAHLSELEAQVEKLKL
ENATLYK-QFTDTS--------------QQFHEADTNNRV-------LKSD---------
-VEALRAKV--KLAEDM--------VTRSSFTTSLN---NQFLHN---------------
------------------------------------------------------------
----------------------QCQMSTP-P-------------------QLNIRRMPHV
SPTINFQQ--------------GNSASYGGVAV-------------GVH---NSNL--A-
----G-FGNLDMTYNDVVDNGVLSNAMSCVT--IW------------------P
>gi|13365772|dbj|BAB39174.1|	   278 residues, 50 /line  RISBZ4 [Oryza sativa]
MDIEAFIHGGSGGGD--ADADHPL--------------------GIFSAADLSGF-----
------------------------------------------------------------
---------------------------------------------------------GFA
DSSTITGG----------IPNHIWP--------------------QS------QNLNARH
PAVS--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------TTIESQSSICAAASPTSATNLNMKESQTLG
GTS--------------GSDSES-------------------ESLLDIEGGPCEQSTNPL
DVKRVRR----------------------MVSNRESARRSRKRKQAHLADLESQVDQLRG
ENASLFK-QLTDAN--------------QQFTTSVTDNRI-------LKSD---------
-VEALRVKV--KMAEDM--------VARGALSCGL----GHLGGL---------------
------------------------------------------------------------
----------------------SPALNPRQA-------------------CRVPDVLAGL
DYAGDDPFTAG----LSQPEQLQMPGGE--------------------------------
-----------------VVDA--------------WG-----WDNHPNGGMS-K
>gi|140041098|gb|ABE94298.2|	   323 residues, 50 /line  NAD, putative [Medicago truncatula]
MEISNSL-----PNF--QDHQLPP--------------------KISNSSRYDEI-----
------------------------------------------------------------
---------------------------------------------------------CLK
ERLMSELGNEG------GIRRHQRT--------------------YSDSMLSEQQQQEVP
CWLK--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------DLLDDEEDQKQPSTVCSNKTHRRSSSDSLA
YLN------------NKTILQHS-------------------PERKVVDSQPSFLQQ--H
HSRSDHS----------------------KRGKRNSGQQHRARKAQYIGELERSVQALQA
EGYEVSA-ELEFLD--------------QQNLILGMENRA-------LKQR---------
-LDSLSQEH--FIKCLE--------------QEVLE---REITRL---------------
------------------------------------------------------------
----------------------RNLYQQQQH-------------------KQHQQSSNNK
RIMASCILPLV----LHEIGAYGLVRINMEL--FFHAHSIFCPWLMILGSTQI-------
-IYAASTSFVMIDYVFFILTK--------------WAEWISQCQKYSRFSLSYR

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.