FANDOM


&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g12940-1hjb_A.pir.txt

======================================================

Assigned types to 220 residues in Sequence 2-12940, 0 remain unknown
Assigned types to 82 residues in Sequence 1hjb_A, 138 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Translated sequence file At2g12940-1hjb_A.pir.txt into sequence alignment.

======================================================

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code T for amino acid

>1HJB.pdb  Made from 6276 ATOM records in 1HJB.pdb
DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKV
EQLSRELSTLRNLFKQDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQH
KVLELTAENERLQKKVEQLSRELSTLRNLFKQLGELVRTDSPNFLCSVLP
THWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKN
QVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREP
RRHDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQ
KKVEQLSRELSTLRNLFKQLPDKHSDEYKIRRERNNIAVRKSRDKAKMRN
LETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPGELVRTDSPNF
LCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA
TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITV
DGPREPRRHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXX

======================================================

Best alignment:
1HJB.pdb   318  KQLPDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERL   367
                K+  DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERL
1hjb_A       4  KKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERL    53

1HJB.pdb   368  QKKVEQLSRELSTLRNLFKQLPGELV   393
                QKKVEQLSRELSTLRNLFKQLP  L+
1hjb_A      54  QKKVEQLSRELSTLRNLFKQLPEPLL    79

======================================================

Highlighted IDENTICAL residue LYS  332  index1  318  path  141  %Seq 100.00
Highlighted IDENTICAL residue ARG  277  index1  331  path  154  %Seq 100.00
Highlighted IDENTICAL residue ASN  281  index1  335  path  158  %Seq 100.00
Highlighted IDENTICAL residue LYS  291  index1  345  path  168  %Seq 100.00
Highlighted IDENTICAL residue HIS  301  index1  355  path  178  %Seq 100.00
Highlighted IDENTICAL residue GLU  309  index1  363  path  186  %Seq 100.00
Highlighted IDENTICAL residue ASN  310  index1  364  path  187  %Seq 100.00
Highlighted IDENTICAL residue LYS  316  index1  370  path  193  %Seq 100.00
Highlighted IDENTICAL residue LEU  320  index1  374  path  197  %Seq 100.00
Highlighted IDENTICAL residue THR  326  index1  380  path  203  %Seq 100.00
Highlighted IDENTICAL residue LEU  327  index1  381  path  204  %Seq 100.00
Highlighted 11 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g12940-1hjb_A.pir.txt.1HJB.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g12940-1hjb_A.pir.txt PIR amino_acid 1HJB.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.