Fandom

Proteins Wiki

At2g12940.1/MSA

< At2g12940.1

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|79554734|ref|NP_178948.2|	   220 residues, 50 /line  UNE4 (unfertilized embryo sac 4); transcription factor [Arabidopsis thaliana]
---MNGSD----------NTTPSRPWSITQPS----------------------------
------------------------------------------------------------
------------------------------------------------------------
----LAF--------------------------SSLPPLSPSPSSSRRNSLPLM--NPST
SMESRDSSMRFKKNSLLPPLGVKKIAPK-DIGPLKRHYRSVSMDSCLSDLLKLTPSPGNT
-------------------PSSRLVDGD-----------QNA---SRLEFDANDYTD---
-----DELNKIAKSNKL---K---------EVALDPKEVRRILKNRESAAHLKQKKL---
---------QYMINLEHRINFVENENASIFEKIKLLEVK---------------------
---------HIT-LAT--------------------------------------------
----------------------------------------------ISLSCLNGIYK---
-------------------------------------------------KV---------
T
>gi|108862928|gb|ABA99797.2|	   210 residues, 50 /line  bZIP transcription factor family protein, expressed [Oryza sativa (japonica cultivar-group)]
---MKRGGAGVG------------------------------------------------
------GGGGGGDPGAYAA----------VLKTKLDLYCAAVAKSMEAKLQESSL-----
------------------------------------------------------------
---------------------------------------------------------GYL
NLQASDTSQLVSQDSFN-------------------------------------GYGSTR
VTNSNAIHED--------------------------------------------------
-----DDQGKPANSGTSKEQSDDDGDLEEDTDPVNAKRTRRMLSNRESARRSRKRKQ---
---------AHLNDLESQVSQLRSENASLQKRLSDMTQK---------------------
---------YKQ-STT-----------EYGNLQDDMNAMRRKVFSFC-------------
CCDRL--------------------ITSSTSF----------------------------
--------------------------------------------------IPIEG-----
L
>gi|113367250|gb|ABI34682.1|	   188 residues, 50 /line  bZIP transcription factor bZIP51 [Glycine max]
-------------------RGRMPDNPPRNR-----------------------------
------------------------------------------------------------
--------------GHRRAHSEILTLPDDISF-------DSDLGVVGAGDGPSFSDDAEE
DLLSMYLDMDKFNSSSATSTFQMGE-PSNAVGASASTPGSGAPNYSAENVV---------
--------------------------FGTIERPRVRHQHSQSM-----------------
----------------------------------DGSTTIKP---ELLVSGSEDMSA---
-----ADSKKAISAAKL-----------AELALIDRRRADRIWANRQSAARSKERKM---
---------RYIAELDRK------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-
>gi|113367256|gb|ABI34685.1|	   233 residues, 50 /line  bZIP transcription factor bZIP43 [Glycine max]
---MDLSPS--------------DPF----------------------------------
------------------------------------------------------------
--------------------------------------------AGGSSTASMEEIGSED
DLFSTYIDVDKLGGA-------NGSGASGNGADPTGETEKSPARP---------------
------------------------------------------------------------
-------------------RHRHSSSVDF--------------G------------EI--
-----MDAKKAMPPDKL-----------AELWTIDPKRAKRILANRQSAARSKERKA---
---------RYIQELERKVQTLQTEATTLSAQLTLYQRD---------------------
---------TTG-LST-----------ENTELKLRLQAMEQQAQLRDAL------NEAL-
-----------------------------------KKEVERLKVATGEMMSHT-DSFNLG
MHLMPF-----------SGSNFVP---------IPAQSGPSGHQNMQMP-----------
P
>gi|79317079|ref|NP_001030982.1|	   250 residues, 50 /line  DNA binding [Arabidopsis thaliana]
---MEKSDP--------------PPVPKPGATIIPSSDPIPNADP---------------
------------------------------------------------------------
-------IPSSSFHRRSRSDDMSMFMFMD--------------PLSSAAPPSSDDLPSDD
DLFSSFIDVDSLTSN--PNPFQNPSLSSNSVSGAANPPPPPSSRP---------------
------------------------------------------------------------
-------------------RHRHSNSVDA--------GCAMYAG------------DI--
-----MDAKKAMPPEKL-----------SELWNIDPKRAKRILANRQSAARSKERKA---
---------RYIQELERKVQSLQTEATTLSAQLTLYQRD---------------------
---------TNG-LAN-----------ENTELKLRLQAMEQQAQLRNAL------NEAL-
-----------------------------------RKEVERMKMETGEISDA--------
------------------------------------------------------------
F
>gi|115484313|ref|NP_001065818.1|	   200 residues, 50 /line  Os11g0160500 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------MD--------GESSL---FEGESAP-----P--
-----DYAKKAMPADRL-----------AELALLDPKRAKRILANRQSAARSKERKI---
---------KYTGELERKVQTLQTEATTLSTQLTLLQRD---------------------
---------TSG-LTA-----------ENRELKLRLQSMEEQAKLRDAL------NDAL-
-----------------------------------REEVQRLKIAAGQVPNMNGNSFNGG
LQQQQQQQMPTYFSQQQQMHYLSGHQ-GRHHHPNNPHNSLNGGQSMSGQTLNDSMDFM--
-
>gi|19401702|gb|AAL87668.1|	   191 residues, 50 /line  susceptibility transcription factor RVS1 [Oryza sativa]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------HASV-----P--
-----DYAKKAMPAERI-----------AELALIDPKRAKRILANRQSAARSKERKI---
---------KYTSELERKVQTLQTEATPLSAQLTLLQRD---------------------
---------TSG-LTA-----------ENRELKLRLA-VHGKSKLTTVMLW----NEAL-
-----------------------------------REEVQRLKIAAGQAPNMNGNPFNGG
LQQQIPPYYTQQQQQQQQMPYLGGHH-AQQRHPSHQQSSSNGGQSLSGQSLNDSMDFM--
-
>gi|145652375|gb|ABP88242.1|	   184 residues, 50 /line  transcription factor bZIP129 [Glycine max]
------------------------------------------------------------
------------------------------------------------------------
---------------------ADSAMIMD-------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------GVKKAMAPDKL-----------AELALMDPKRAKRILANRQSAARSKERKI---
---------RYTSELERKVQTLQTEATNLSAQLTMLQRD---------------------
---------TTD-LTT-----------ENKELKLRLEALEQEAQLREDL------NEAL-
-----------------------------------KEELQRLRAQSTRLGAIGGNPSFGG
IFNQLASQLAM-----QQLSNSAPHQ-QTQHQPQVGMPPP-----PSGQNHPNFMDFNQ-
Q
>gi|7258340|gb|AAF37279.4|	   261 residues, 50 /line  VirE2-interacting protein VIP1 [Arabidopsis thaliana]
---MSVDSE--------------E--TSSNGVVPPNSLP-----P---------------
------------------------------------------------------------
-------KPEARFGRHVRSFSVDSDFFDD--------------------------LGVTE
EKFIA-----------------------------TSSGEKKKGNH---------------
------------------------------------------------------------
-------------------HHSRSNSMDG--------EMSSASFNIESILASVSGKDS--
-----GKKNMGMGGDRL-----------AELALLDPKRAKRILANRQSAARSKERKI---
---------RYTGELERKVQTLQNEATTLSAQVTMLQRG---------------------
---------TSE-LNT-----------ENKHLKMRLQALEQQAELRDAL------NEAL-
-----------------------------------RDELNRLKVVAGEIPQGNGNSYNRA
QFSS--QQSAM-----NQFGNKTNQQMSTNGQP----------------SLPSYMDFTKR
G
>gi|115434804|ref|NP_001042160.1|	   203 residues, 50 /line  Os01g0174000 [Oryza sativa (japonica cultivar-group)]
---MAAQEQEQEKQQVKTSTTSSLPSSSE----RSSSSAPNN--LKEG------------
-----------------------------------------GGVESDEEIRRVP------
---------------------EMGGGGGSASSGAGADERQ--------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------GKEDG---KQ----------QGG
GGG-GAAAAGGGQEQAP---PARK--RGRSAGDKEQNRLKRLLRNRVSAQQARERKK---
---------AYMTELEAKAKDLELRNAELEQRVSTLQNE---------------------
----------------------------NNTLRQILKNTTAHAGKRGGGGGGKGG-----
------------------DGGGGGKKHHFTK-----------------------------
------------------------------------------------------------
S
>gi|125524621|gb|EAY72735.1|	   194 residues, 50 /line  hypothetical protein OsI_000582 [Oryza sativa (indica cultivar-group)]
---MAAQEQEQEKQQAKTSTTSSLPSSSE----RSSSSAPNN--LKEGG-----------
-----------------------------------------GGVESDEEIRRVP------
---------------------EMGGGGGSASSGAGADERQ--------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------GKEDG---KQ----------QGG
GGGGGGAAAGGGQEHAP---PARK--RGRSAGDKEQNRLKRLLRNRVSAQQARERKK---
---------AYMTELEAKAKDLELRNAELEQRVSTLQNE---------------------
----------------------------NNTLRQMCFYSLPIEALQTKRKPFLG------
----------------------------LTG-----------------------------
------------------------------------------------------------
Y
>gi|46390088|dbj|BAD15505.1|	   188 residues, 50 /line  putative bZIP protein HY5 [Oryza sativa (japonica cultivar-group)]
---------------MQEQATSSRPSSSE----RSSSSGGHHMEIKEGK-EAPLRSLLLP
FLDFHFTVPL-------------------------------SGMESDEEIGRVP------
---------------------ELGLEPGGAST----------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------SG---RA----------AGG
GG-GGAERAQS-STAQA---SARR--RGRSPADKEHKRLKRLLRNRVSAQQARERKK---
---------AYLNDLEVKVKDLEKKNSELEERFSTLQNE---------------------
----------------------------NQMLRQILKNTTVSR---RGPGSTAS------
----------------------------GEG-----------------------------
------------------------------------------------------------
Q
>gi|115440013|ref|NP_001044286.1|	   265 residues, 50 /line  Os01g0756200 [Oryza sativa (japonica cultivar-group)]
-------------------MAQLPPKIPVAAP----------------------------
--------------------------------------------GHHQHWASAGGAGDAA
WADEFAEFAASRRGAHRRSLSDSVAFVEVAP--------------AGCGAGGEFDRLDDD
QLMSMFPDEG----------------------------------GS--------------
------------------------------------------------------------
-------------------SAPGSDNGGSDSDG----GGDKH---AA-----------AQ
SDDGQHA---AGEPTQE---QAAA--TSPTELIRDPKRVKRILANRQSAQRSRVRKL---
---------QYISELERSVTTLQNEVSVLSPRVAFLDQQ---------------------
---------RTI-LTV-----------GNSHLKQRIAALAQDKIFKDAH------QEAL-
-----------------------------------RKEIERLRQ--VYQQQNTKLSG--G
-LAADHAHVHG-----GPPP-----------------------------VRAEKELM---
S
>gi|125581476|gb|EAZ22407.1|	   269 residues, 50 /line  hypothetical protein OsJ_005890 [Oryza sativa (japonica cultivar-group)]
-------------------MAQLPPRAPSAAA----------------------------
--------------------------------------------AAGQEWSAMAAAG---
---EFLGFAAARRGAHRRSASDSAAFLMEAAV-------PMDDVIVGVGGGGEFDRLDDE
QLMSMFSDVE--------------------------------------------------
------------------------------------------------------------
--------------------APAVSDGGGERGP----AGEAH---LM---------DMGD
GDDGMGATSPAGAGAMA---AAAA--GGAADGIADPKRVKRILANRQSAQRSRVRKL---
---------QYISELERSVTTLQMEVSALSPRVAFLDHQ---------------------
---------RSL-LTV-----------GNSHLKQRIAALAQDKIFKDAH------QEAL-
-----------------------------------KKEIERLRQ--VYHQQQIKATG--G
ADIATAASMQA-----KHEL-----------------------------LACEGAAM---
R
>gi|145652335|gb|ABP88222.1|	   170 residues, 50 /line  transcription factor bZIP48 [Glycine max]
-------------------KSQCKQEI---------------------------------
------------------------------------------------------------
-----------------------------------------------------TQLPNND
DSNNT-------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------S---NANA--TCSSEKITDPKRVKRILANRQSAQRSRVRKL---
---------QYISELERSVTSLQAEVSVLSPRVAFLDHQ---------------------
---------RLL-LNV-----------DNSALKQRIAALAQDKIFKDAH------QEAL-
-----------------------------------KREIERLRQ--VYHQQNIKKMD--N
NAAASPPSQSP-----SPSPKPRC------------------------ETHTEKEQLI-N
V
>gi|145652339|gb|ABP88224.1|	   194 residues, 50 /line  transcription factor bZIP58 [Glycine max]
------------------------------------------------------------
----------------------------------------------------------IT
YLDSPVKCGGNKNNNN---------------------------------NENEFDKFDDE
QFMSMFTDEV---------------------VLSGVPLPPPTTLSS--------------
------------------------------------------------------------
-------------------SNPSSPYDQNFIND----EKEKK---EEEEEHHHHHQLKNE
ADEVESQCKQEIMQLPN---DTNT--CSSSERITDPKRVKRILANRQSAQRSRVRKL---
---------QYISELERSVTSLQAEVSVLSPRVAFLDHQ---------------------
---------RLL-LNV-----------DNSALKQRIAALAQDKIF---------------
------------------------------------------------------------
------------------------------------------------------------
-
>gi|115464109|ref|NP_001055654.1|	   179 residues, 50 /line  Os05g0437700 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
-----------------------------------------ARRTAEEVWKEIS------
---------------------SSGGLSAPAPAPAAG--------AAGRGGGPEMT---LE
DFLAREDDPRA-------------------------------------------------
------------------------------------------------------------
-------------------------------------TAVEG---NMVVGFPNVTEG--V
GTAGGGRGGGGGGRGRK----RTL---MDPADRAAMQRQKRMIKNRESAARSRERKQ---
---------AYIAELEAQVAELEEEHAQLLREQEEKNQKR--------------------
LKEIKEQAVAV-VIRK-----------KTQDLR---------------------------
-------------------------RTNSME-----------------------------
------------------------------------------------------------
W
>gi|46981289|gb|AAT07607.1|	   247 residues, 50 /line  unknown protein [Oryza sativa (japonica cultivar-group)]
---MASSRVMAA---AAASSSSSPPPPPPAAAAAGGAADLARFRSTSSG----IGSMNMD
--DILRNIYGEAAPPPGAAGSAPAPPP-AGEAAGAPVAEVAARRTAEEVWKEIS------
---------------------SSGGLSAPAPAPAAG--------AAGRGGGPEMT---LE
DFLAREDDPRA-------------------------------------------------
------------------------------------------------------------
-------------------------------------TAVEG---NMVVGFPNVTEG--V
GTAGGGRGGGGGGRGRK----RTL---MDPADRAAMQRQKRMIKNRESAARSRERKQ---
---------AYIAELEAQVAELEEEHAQLLREQEEKNQKR--------------------
LKEVSLI-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
V
>gi|1753085|gb|AAB39320.1|	   217 residues, 50 /line  leucine zipper protein
-------------------------MPTPALPLVGGDRPM--------------------
---------------------SPLPAP---DVAA-------APRTAEEVWKEITGAGVAA
---------------------AAGGVVPPAAAAAAA---PAVVAGAGAGTGAEMT---LE
DFLAREGAVKE------------------DEAVVT-------------------------
------------------------------------------------------------
-----------------------------------DPSAAKG---QVVMGFLNGAEV--T
-------GGVTGGRSRK----RHL---MDPMDRAAMQRQKRMIKNRESAARSRERKQ---
---------AYIAELESLVTQLEEENAKMFKEQEEQHQKR--------------------
LKELKEMVVPVIIRKT-----------SARDLR---------------------------
-------------------------RTNSME-----------------------------
------------------------------------------------------------
W
>gi|119552395|gb|ABL84199.1|	   217 residues, 50 /line  self-pruning G-box protein [Solanum lycopersicum]
--------MWS-------SSSDNRGLSASSSSSSSSS-----------------------
-----------------------------------HSPFSPRLKTMEEVWKDIN------
---------------------LSSLQDHTT--NYSRDHHHLHDHNHQAANFGGMI---LQ
DFLARPFANES------------------SPAAAAAAASP--------------------
-------------------------------------------------------VSATT
MLNLNSVPELHF--------------------------FDNP---LRQNSI---------
-------LHQPNASGRK---RVVP---ETEDNSTGDRRNQRMIKNRESAARSRARKQ---
---------AYMNELESEVAHLVEENARLKKQQQQLRVD---------------------
---------AANQVP------------KKNTLY---------------------------
-------------------------RTSTAP-----------------------------
------------------------------------------------------------
F
>gi|125575496|gb|EAZ16780.1|	   265 residues, 50 /line  hypothetical protein OsJ_030989 [Oryza sativa (japonica cultivar-group)]
---MEAGGGWA-------------------------------------------------
----------------------------------LPGCGGAGEVDLLNAYMSLE------
---------------------GMGG-----ADGLNNSDG---------------------
------------------------------------------------------------
--DSRGSSMRTNGADS--------------------------------------------
------SENESEDY----------------------VGADSQ---ALLWAAPGAGKASGK
KRRNNAAGEKA------APEREEP--FHGQPHGEAQLRRQWVLANRQSAARSKERRM---
---------RYIAELEQKVQILQTEATTLSAQLTLLQRD---------------------
---------SSG-MAT-----------QNNELKFRLQSMEQQAQLRDAL------NEAL-
-----------------------------------TAEVQRLKLAANEVCDTSSSS-NLA
HQIQLRCQNQM-----LDLHKQQQQ---QVEQIPFYQLELPEQQNGTAR----NHES---
K
>gi|15219608|ref|NP_171893.1|	   270 residues, 50 /line  GBF4 (G-box binding factor 4); transcription factor [Arabidopsis thaliana]
---MASFKLMS-------SSNSDLSRRNSSSASSSPS-------IRSSHHLRPNPHADHS
--RISFAYGGGVNDYTFASDSKPFEMAIDVDRSIGDRNSVNNGKSVDDVWKEIV------
---------------------SGEQKTIMMKEE---------------EPEDIMT---LE
DFLAKAEMDEG------------------ASDE---------------------------
--------------------------------------------------IDVKIPTERL
-------------------NNDGSYTFDFPMQRHS------------------------S
FQMVEGSMGGGVTRGKR---GRVM---MEAMDKAAAQRQKRMIKNRESAARSRERKQ---
---------AYQVELETLAAKLEEENEQLLKEIEESTKER--------------------
YKKLMEVLIPVDEKPR----------PPSRPLS---------------------------
-------------------------RSHSLE-----------------------------
------------------------------------------------------------
W
>gi|18397171|ref|NP_565355.1|	   264 residues, 50 /line  DNA binding / transcription factor [Arabidopsis thaliana]
---MNGSDNI---------TTPSGSRSMTQPSLAS-------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------SSLPPLSPSSSTFRRNSLPSMSFSPSA
PVESRDSSIKVNKNPSLPPLVD--------------------------------------
-------------------------------------GEEDA---SWLEFGSSDYTD---
-----DELNKIAKSTKLQDIAKS---TKLQEIVSDPKKVRRILKNRELAASSKQRKL---
---------KYMIDLEHRIKFLENKNALIFEKIKLLEKD---------------------
---------KTI-LMN-----------EKKEITIQIESLEQQAQLRDAL------TEKL-
-----------------------------------HVEIERLKV--ITISNEKGSVELQR
LKMETCEVLQY-----RREFDRSNM---QGMDPN--------MFTWSQPNLGFYGQ----
I
>gi|18698670|gb|AAL78371.1|	   186 residues, 50 /line  Vsf-1 protein [Oryza sativa]
---------------------------GRASGTRTGSVADSSENEAESHSTPV-------
-------------------------------------------------ERKDG------
---------------------GGKSR-----------------------HCRSLS---VD
SFIEKLNFDE------------------------SPKLPLPSP-----------------
--------------------------------------------------------SGGL
-------------------SRSGSGSLDG--------GAASL---FGAEFANGEFTE---
-----AEKKKIMANERL-----------AEIALTDPKRVKRILANRQSAARSKERKM---
---------RYIQKLEHKVQVLQTEASTLSHSLKCLRR----------------------
---------TPW-TSP-----------QNNELKLGCSMDHSPV-----------------
------------------------------------------------------------
------------------------------------------------------------
-
>gi|42408548|dbj|BAD09726.1|	   221 residues, 50 /line  putative vsf-1 protein [Oryza sativa (japonica cultivar-group)]
----MEALNS--------SEERHEDRDSRASGTRTGSVADSSENEAESHSTPV-------
-------------------------------------------------ERKDG------
---------------------GGKSR-----------------------HCRSLS---VD
SFIEKLNFDE------------------------SPKLPLPSP-----------------
--------------------------------------------------------SGGL
-------------------SRSGSGSLDG--------GAASL---FGAEFANGEFTE---
-----AEKKKIMANERL-----------AEIALTDPKRVKRILANRQSAARSKERKM---
---------RYIQELEHKVQVLQTEATTLSAQLTMLQRD---------------------
---------STG-LAT-----------QNNELKIRLQAMEQQAQLRDDK-----------
--------------------------FVSKSFPSF-------------------------
------------------------------------------------------LSW---
R
>gi|92090807|gb|ABE73183.1|	   264 residues, 50 /line  ABA response element binding factor [Avena fatua]
PAHAAHAQAA--------QALPQPPVQPP-------------------------------
------------------------------------------------------------
-----------------------------------AVNGGGIAENDRQGTLGEMT---LE
QFLVKAGVVRG------------------SLGGGQAPPMPVGMVHGPIHPMQQG------
--------------------------QHQQPGPLMYQVAPVNAMYPGMGD----------
------------GMGFVPNGYTGMAVVPPPAPSQGGVGIVSP---GSSDGRSAMTQADAM
NCIGSGAMVMENGAARK---RPAP--EDRPGERSVERRHRRMIKNRESAARSRARKQ---
---------AYTVELEAELNELKEENARLKAEETTILLAK----------------KQML
LEKMMEQSKENAKAKK-----------GGARPR---------------------------
-------------------------RSGSCI-----------------------------
------------------------------------------------------------
W
>gi|92896938|gb|ABE93450.1|	   247 residues, 50 /line  Basic-leucine zipper (bZIP) transcription factor [Medicago truncatula]
------------------------------------------------------------
---------------------------------------------MEEVWKDIN------
---------------------LSSLNDQNT--------RPMIMSTRNSTFGGGVI---LQ
DFLTRPLTL------------------------------DPTKSLDYSSNNSSS--SVAS
DQNNNNASFYCPISTTPPPL--------------------------------------VT
ALSLNSRPDFLYDPLIRHNKHNNSQLLLQQQQHNIGVSNVSP---CFVNASPCDQNVG--
-----VPASSSFTCFGK-----RF--GEAPDISPGERRNKRMIKNRESAARSRARKQEKI
TSFLFSKFSAYTNELEQKVQLLQEENARLRRQQQELWE----------------------
--------AESGGQQK-----------KKSSLY---------------------------
-------------------------RTSSF------------------------------
------------------------------------------------------------
-
>gi|125586088|gb|EAZ26752.1|	   219 residues, 50 /line  hypothetical protein OsJ_010235 [Oryza sativa (japonica cultivar-group)]
---MSSHQGS-------------------GGVSRQGSLCGLALSEVEGQ----LHGVNLD
--DLLRTGGGGA----------------------GAGAAAAGRKTVDEVWRDIQ------
---------------------GATGNGFLRPAG---------------AAAGQMT---LE
DFLSRAGAD------------------------------SGSGG----------------
------------------------AGGADGARWARAHHHHVGRPVPRP---------LGL
-------------------GAGPVLDALYHD-----------------------------
--------GPVSGSKRA---PAAG--EGAAAEKTVERRKKRMIKNRESAARSRARKQ---
---------AYTNELENKISRLEEENKRLRMHKVSK---------------------PVF
VHHFQE------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
P
>gi|33146493|dbj|BAC79602.1|	   269 residues, 50 /line  putative bZIP protein DPBF3 [Oryza sativa (japonica cultivar-group)]
---MSCHGGG--------GGGGE------GALSRQGSVYSLTLNEVESHLGEPLRSMNLD
--DLLRTVLPAA----------------------AAAAETAGRKTVDEVWRDIQ------
---------------------GASTG---RHHA---------------TPMGEMT---LE
DFLSRAGVA------------------------------VDG------------------
------------------------AASAAGAHWLRGHYP----PPPPP---------TTT
TLQYVG-------------GSGAVVDGVYNR--------VDG---HGVAGF---------
-------LSQVGVAGRK---RGGG--VDGVVEKTVERRQKRMIKNRESAARSRARKQ---
---------AYTNELENKISRLEEENQRLREHKAVADFSTFPS---------CVDFLKAF
LTQKLEPVMQIVPQPE-----------PKQQLR---------------------------
-------------------------RTTSAS-----------------------------
------------------------------------------------------------
F
>gi|145652341|gb|ABP88225.1|	   207 residues, 50 /line  transcription factor bZIP70 [Glycine max]
--------------------------------------GEKKFQDRXPX-----------
------------------------------------------------------------
--------------------------------------------------LGEMT---LE
DFXXXAGVV------------------------------AGAXXNRTN-XSTIA--GVDS
NVAV--------------------PQFXSQAQWIQYPQAQYQHPPQSLMGMYMPSQGMVQ
PLHM---------------GAGASLDVSFADNQ----M-AMP---SSLMGT---------
-------MSDTQTPGRK---KSTS---EDMIEKTVERRQKRMIKNRESAARSRARKQ---
---------AYTNELENKVSRLEEENERLRKRKEL-------------------------
-----EQMLSCAPPPE-----------PKYQLR---------------------------
-------------------------RIASAP-----------------------------
------------------------------------------------------------
F
>gi|113367242|gb|ABI34678.1|	   190 residues, 50 /line  bZIP transcription factor bZIP9 [Glycine max]
---MASSKLV--------STNPDLPRDPSSSSSSSSS--ISPLSSLLSDL------HPMD
--DLLKS---------------------------------ITPNSVDDFWKGIA------
---------------------AAST-----------------------DNAGGVT---LE
DFLTKAIPVTE------------------EDVRGAPPPPP-----SF-------------
---------------------------------------------------------LPF
-------------------PAEGSSSSVEPF-------------------ANNGVGS---
-----AP-SNSVQKGKR----RAV---EEPVDKATLQKLRRMIKNRESAARSRERKQ---
---------AYTSELEYLVHQLEQENARLLKEEVRF------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-
>gi|145652387|gb|ABP88248.1|	   239 residues, 50 /line  transcription factor bZIP10 [Glycine max]
---MASSKVV--------STNPDLPRNSSSSSSSSSTSPISPLSSLLSDL------HPMD
--DILKS---------------------------------ISPKSVDDVWNDIV------
---------------------TGATVHDAVSATTT------------DNADAAMT---LE
DFLTKAI--RE------------------EDVRGAPPPPPPPPPSSF-------------
---------------------------------------------------------LPF
-------------------PADGSSSSVEPF-------------------A-NGVSA---
-----AP-SNSVQKGKR----RAV---EEPVDKATLQKQRRMIKNRESAARSRERKQ---
---------AYTSELEYLVHQLEQENVQLLNEEAEMRRQR--------------------
KKQLFECIIPIEVMPK-----------PKKKLR---------------------------
-------------------------RVNSAQ-----------------------------
--------------------------------------------------------S---
L
>gi|118430802|gb|ABK91939.1|	   204 residues, 50 /line  delayed flowering1 [Zea mays]
---MEDDE---------------DIWANTASS----------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------PSASPPQPVAAGSVSTCSAFI--STQL
SLNSRLHLLSSAAAGGGSSPVRGGAYGADGV---------RHHHMALGGGFRNAAA----
-------------------------------SQ----GSFFP---YNLAGAGADVAP---
-----FDGGRGVLEDDMSVGAAAS---GTWAGGGTDRRKKRMIKNRESAARSRARKQ---
---------AYVRELETKVQLLQQENESLRVKYDELRES---------------------
---------VEVAVPM-----------VRKTLQ---------------------------
-------------------------RMPSAP-----------------------------
------------------------------------------------------------
F
>gi|125576613|gb|EAZ17835.1|	   248 residues, 50 /line  hypothetical protein OsJ_032044 [Oryza sativa (japonica cultivar-group)]
---MGGGG----------GGGQAAPWG-----GVQEY--YAKPSS---------------
---FGRH-----------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------QGRP
WEQGMNNLVNYRQSGGPPMPAK----------------------------------EKVG
-------------------GHHGSPSVLRDHDH----GMDRR---SSDESG-HDQKV---
-----GPERKEGVPPK------------HAQSEADTKRA-----KQQYAQRSRVRKL---
---------QYIAELERKVQALQSEGIDVSAEMEFLSQQ---------------------
---------NIM-LDL-----------ENKALKQRLESLAQEQLIKRFQ------QEMF-
-----------------------------------EREIGRLRS--LYQQQQQQ------
-----QKQPQP-----TTTLSRSNS---RDLDSQFANLSLKHKDPNSGPLRTQSSSI---
L
>gi|145652381|gb|ABP88245.1|	   209 residues, 50 /line  transcription factor bZIP63 [Glycine max]
----------------------------------------TNPVG---------------
---VPSG-----------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------KDSA
AFQSSGLQCTPHEADALPPAAS--------------------------------------
---------------------------------------EKH---DSVELGLQDAKS---
-----FPEKKDISHAK------------SSASETDTKRA-----KQQFAQRSRVRKL---
---------QYIAELERNVQALQAEGSEVSAELEFLNQQ---------------------
---------NLI-LSM-----------ENKALKQRLENIAQEQLIKYLE------QEVL-
-----------------------------------EREIGRLRA--LYQQQQQPPQT---
-----QPQQQP-----SGSHRRSNS---RELESQFANLSLKHKDTNSGQ---DPALR---
I
>gi|2228773|gb|AAC49760.1|	   174 residues, 50 /line  Dc3 promoter-binding factor-2 [Helianthus annuus]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------MT---LE
DFLVKAG------------------------------VVAESSPGKVN-EEGNL--EPQ-
-----------------------------ETQWIGYQSHAVQQQNMIMAGHYQVQPSVTV
-------------------PGNSLMDVGY----------MSP---TSLMGS---------
-------LSDRHMSGRK---RFAS---GDVMEKTVERRQKRMIKNRESAARSRARKQ---
---------AYTHELENKVSRLEEENERLRREKEVEKVI---------------------
---------PWVPPPK-----------PKYQLR---------------------------
-------------------------RTSSAP-----------------------------
------------------------------------------------------------
F
>gi|3273764|gb|AAC24835.1|	   246 residues, 50 /line  Dc3 promoter-binding factor-3 [Helianthus annuus]
----------------------------QHVPGPSLA--RQSSIN---------------
---LAQD---------------------------------LRKKTVDEVWQGIQ------
---------------------QGKNKGSNNSSGSGNNDGDKRGNRERQPTLGEMT---LE
DFLLKAG------------------------------VVTGSGKKNVDVNQENA--NHQ-
-----------------------------QAQWMQYQVAPIPQQHVYMSGHHPVQQSLSI
-------------------GANPMMDMVYPETQ----MAMSP---SHLMHN---------
-------LSDTQTPGRK---RVAS---GDVIEKTVERRQKRMIKNRESAARSRARKQ---
---------AYTHELENKISRLEEENELLKRQKEVGMVL---------------------
---------PSAPPPK-----------PKYQLR---------------------------
-------------------------RTSSAS-----------------------------
------------------------------------------------------------
F
>gi|15224966|ref|NP_178956.1|	   262 residues, 50 /line  transcription factor [Arabidopsis thaliana]
---MNGSD----------NSTPSRPRSITQPS----------------------------
------------------------------------------------------------
------------------------------------------------------------
----LAF--------------------------SSLPPLSPSPSSSRRNSIPLM--NPSA
SVESRDSSIRVKKKSLLPPLCVKRRAPKDDIEPFKRHYRSLSVDSCLSDLLKLPPSPNNV
-------------------SSSRSVDGE-----------QNA---SELEFDTSVYTD---
-----DELNKIAKSTKL---K---------EVASDPKEVRRILKNQESAARSKQKKL---
---------QYMINLELKINFLENKNASIFEKIKLLEND---------------------
---------KTM-RMN-----------EKKEIMIRIESLEQHAELRDAL------TEHL-
-----------------------------------HVEIERLKA--VLISNEKGNEK---
-------------------------------------------------SPKSRDDN---
M
>gi|28317383|tpe|CAD29861.1|	   234 residues, 50 /line  TPA: putative basic leucine zipper transcription factor [Arabidopsis thaliana]
---MLSSA----------KHNKINNHSAFSISSSSSS--LSTSSS---------------
---LGHN---------------------------------KSQVTMEEVWKEIN------
---------------------LGSLHYHRQL-------NIGHEPMLKNQNPNNSI---FQ
DFLNMPL--------------------------NQPPPPPPPPSSST-------------
------------------------------------------IVTALYGSLPLPPPATVL
-------------------SLNSGVGFEF----------LDT---TENLLASNPRSF---
-----EESAKFGCLGKK---RGQ-----DSDDTRGDRRYKRMIKNRESAARSRARKQ---
---------AYTNELELEIAHLQTENARLKIQQEQLKIA---------------------
---------EAT-QNQ-----------VKKTLQ---------------------------
-------------------------RSSTAP-----------------------------
------------------------------------------------------------
F
>gi|3287219|emb|CAA04639.1|	   199 residues, 50 /line  RITA-2 protein [Oryza sativa (japonica cultivar-group)]
-----TSA----------TNL--NMKESQTLGGTSGS--DSESES---------------
---L--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------LDIEGGPC---
----------------------E-----QSTNPLDVKRVRRMVSNRESARRSRKRKQ---
---------AHLADLESQVDQLRGENASLFKQLTDANQQ---------------------
---------FTT-SVT-----------DNRILKSDVEALRVKVKMAEDMVARGALSCGLG
HLGGLSPALNPRQACRVPDVLAGLDYAGDDPFTAGLSQPEQLQMPGGELVDAWGWDN---
-------------------------------------------------HPN-GGMS---
K
>gi|10176910|dbj|BAB10103.1|	   188 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
------------------------------------------------------------
---MIRHLKPYMESSSVHR-----------------------------------------
--------------------------------------------SHCFDILDGVP---LH
DDHFNSAFLPNTDFN---------------------------VHLQSNV-----------
------------------------STRINN----QSHLDPNAENIFHNE-----------
-------------------GLA--------------------------------------
---------------------------------PEERRARRMVSNRESARRSRMRKK---
---------KQIEELQQQVEQLMMLNHHLSEKVINLLESNHQILQENSQLKEKVSSFHLL
---MADVLLPMRNAESNINDRNVNYLRGEPSNR---------------------------
-------------------------PTNSPF-----------------------------
----------GK------------------------------------------------
-
>gi|15239443|ref|NP_200891.1|	   206 residues, 50 /line  bZIP transcription factor family protein [Arabidopsis thaliana]
------------------------------------------------------------
-----------MESSSVHR-----------------------------------------
--------------------------------------------SHCFDILDGVP---LH
DDHFNSAFLPNTDFN---------------------------VHLQSNV-----------
------------------------STRINN----QSHLDPNAENIFHNE-----------
-------------------GLA--------------------------------------
---------------------------------PEERRARRMVSNRESARRSRMRKK---
---------KQIEELQQQVEQLMMLNHHLSEKVINLLESNHQILQENSQLKEKVSSFHLL
---MADVLLPMRNAESNINDRNVNYLRGEPSNR---------------------------
-------------------------PTNSPF-----------------------------
----------ASSTMIDAMYATSDYYS-----------------------SNYLLAFVCR
Y
>gi|21694632|emb|CAD12766.1|	   226 residues, 50 /line  basic leucine zipper transcription factor [Arabidopsis thaliana]
-------------------------------------------------SGKPLGSMNLD
--ELLKTVLPPAEEGLVRQGS-------------LTLPRDLSKKTVDEVWRDIQ------
---------------------QDKNGNGTSTTT-----------THKQPTLGEIT---LE
DLLLRAGVVTET------------------------------VVPQENV-----------
------------------------VNIASNGQWVEYHHQPQQQQGFMTY-----------
-------------------PVCEMQDM-------------------VMMGGL--------
-------SDTPQAPGRK---RVA----GEIVEKTVERRQKRMIKNRESAARSRARKQ---
---------AYTHELEIKVSRLEEENEKLRR------------LKEVEK-----------
-------ILPSEPPPD-----------PKWKLR---------------------------
-------------------------RTNSAS-----------------------------
-----------L------------------------------------------------
-

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.