Fandom

Proteins Wiki

At2g12900.1/PDB

< At2g12900.1

47,923pages on
this wiki
Add New Page
Talk0 Share
&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g12900-2b9cB.pir.txt

======================================================

Assigned types to 264 residues in Sequence 2-12900, 0 remain unknown
Assigned types to 142 residues in Sequence 2b9cB, 122 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Translated sequence file At2g12900-2b9cB.pir.txt into sequence alignment.

======================================================

>2B9C.pdb  Made from 2301 ATOM records in 2B9C.pdb
ELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQ
LKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEEL
KTVTNNLKSLEDKVEELLSKNYHLENEVARLKKLVGQLVEEELDRAQERL
ATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAE
DADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKS
LEDKVEELLSKNYHLENEVARLKKLVGE

======================================================

Best alignment:
2B9C.pdb    67  EVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEDKVE-   115
                ++  ++  +E+      E+ +L E     L  E K +T  ++SLE + + 
2-12900    143  DLEHRIKFLENKNALIFEKIKLLEKDKTILMNEKKEITIQIESLEQQAQL   192

2B9C.pdb   115  -ELLSKNYHLENEVARLKKLVGQLVEEELDRAQERLATALQKLEEAEKA   163
                 + L++  H+E E  ++  +  +    EL R +      LQ   E +++
2-12900    193  RDALTEKLHVEIERLKVITISNEKGSVELQRLKMETCEVLQYRREFDRS   241

======================================================

Highlighted IDENTICAL residue GLU  173  index1   76  path  152  %Seq 100.00
Highlighted IDENTICAL residue GLU  181  index1   84  path  160  %Seq 100.00
Highlighted IDENTICAL residue LEU  185  index1   88  path  164  %Seq 100.00
Highlighted IDENTICAL residue GLU  187  index1   90  path  166  %Seq 100.00
Highlighted IDENTICAL residue LEU  193  index1   96  path  172  %Seq 100.00
Highlighted IDENTICAL residue GLU  196  index1   99  path  175  %Seq 100.00
Highlighted IDENTICAL residue LYS  198  index1  101  path  177  %Seq 100.00
Highlighted IDENTICAL residue THR  201  index1  104  path  180  %Seq 100.00
Highlighted IDENTICAL residue SER  206  index1  109  path  185  %Seq 100.00
Highlighted IDENTICAL residue LEU  207  index1  110  path  186  %Seq 100.00
Highlighted IDENTICAL residue GLU  208  index1  111  path  187  %Seq 100.00
Highlighted IDENTICAL residue TYR  219  index1  122  path  200  %Seq 100.00
Highlighted IDENTICAL residue GLU  222  index1  125  path  203  %Seq 100.00
Highlighted IDENTICAL residue VAL  225  index1  128  path  206  %Seq 100.00
Highlighted IDENTICAL residue ALA  226  index1  129  path  207  %Seq 100.00
Highlighted IDENTICAL residue ARG  227  index1  130  path  208  %Seq 100.00
Highlighted IDENTICAL residue GLY  233  index1  136  path  214  %Seq  50.00
Highlighted IDENTICAL residue GLN 1093  index1  137  path  215  %Seq  50.00
Highlighted IDENTICAL residue LEU 1094  index1  138  path  216  %Seq  50.00
Highlighted IDENTICAL residue VAL 1095  index1  139  path  217  %Seq  50.00
Highlighted IDENTICAL residue GLU 1096  index1  140  path  218  %Seq  50.00
Highlighted IDENTICAL residue GLU 1097  index1  141  path  219  %Seq  50.00
Highlighted IDENTICAL residue GLU 1098  index1  142  path  220  %Seq  50.00
Highlighted IDENTICAL residue LEU 1099  index1  143  path  221  %Seq  50.00
Highlighted IDENTICAL residue ASP 1100  index1  144  path  222  %Seq  50.00
Highlighted IDENTICAL residue ARG 1101  index1  145  path  223  %Seq  50.00
Highlighted IDENTICAL residue ALA 1102  index1  146  path  224  %Seq  50.00
Highlighted IDENTICAL residue GLN 1103  index1  147  path  225  %Seq  50.00
Highlighted IDENTICAL residue GLU 1104  index1  148  path  226  %Seq  50.00
Highlighted IDENTICAL residue ARG 1105  index1  149  path  227  %Seq  50.00
Highlighted IDENTICAL residue LEU 1106  index1  150  path  228  %Seq  50.00
Highlighted IDENTICAL residue ALA 1107  index1  151  path  229  %Seq  50.00
Highlighted IDENTICAL residue THR 1108  index1  152  path  230  %Seq  50.00
Highlighted IDENTICAL residue ALA 1109  index1  153  path  231  %Seq  50.00
Highlighted IDENTICAL residue LEU 1110  index1  154  path  232  %Seq  50.00
Highlighted IDENTICAL residue GLN 1111  index1  155  path  233  %Seq  50.00
Highlighted IDENTICAL residue LYS 1112  index1  156  path  234  %Seq  50.00
Highlighted IDENTICAL residue LEU 1113  index1  157  path  235  %Seq  50.00
Highlighted IDENTICAL residue GLU 1114  index1  158  path  236  %Seq  50.00
Highlighted IDENTICAL residue GLU 1115  index1  159  path  237  %Seq  50.00
Highlighted IDENTICAL residue ALA 1116  index1  160  path  238  %Seq  50.00
Highlighted IDENTICAL residue GLU 1117  index1  161  path  239  %Seq  50.00
Highlighted IDENTICAL residue LYS 1118  index1  162  path  240  %Seq  50.00
Highlighted IDENTICAL residue ALA 1119  index1  163  path  241  %Seq  50.00
Highlighted 44 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g12900-2b9cB.pir.txt.2B9C.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g12900-2b9cB.pir.txt PIR amino_acid 2B9C.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.