Fandom

Proteins Wiki

At2g12900.1/MSA

< At2g12900.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|18397171|ref|NP_565355.1|	   264 residues, 50 /line  DNA binding / transcription factor [Arabidopsis thaliana]
-MNGSDNITTP------------------------------------SGSRSMTQ-----
----------------------------PS------LASSSLPP----------------
------------------------------------------------------------
-----------------------------------LSPSSSTFRRNSLPSMSFSPSAPV-
----------------------------ESRDSSIKVNKNPSLPPL--------------
------------------------------------------------------------
VDGEED-------ASWLEFGS---SDYTDDELNKIAKSTK--------LQDIAKSTK--L
-Q--------------EIVSDPKK------------------------------VRRILK
NRELAASSKQRKLKYMIDLEH-RIKFLE-NKNALIFEKIKLLE------KDKTILMNEKK
EI-------TIQIESL--EQQAQLR--------------DALTEKLHVEIERLKV-----
------ITISNEKGSVE--------LQRLKMETCEVLQ----------------------
--YR------------------------------------------------REFDRSNM
QGMDPNMF-TWSQPNLGFYGQ-------------I
>gi|111115692|gb|ABH05132.1|	   302 residues, 50 /line  ABA responsive element binding factor 2 [Hordeum vulgare subsp. vulgare]
----------------------------GGAGKDFGSMNMDELLRNIWT-----------
-------AEESNAIAATLTTATTAVPTSNVDAQP--QPPPPQQQQQAILRQGSITLPRTL
SQMTVDEVWRDIMGF--CDEE--------------PPPPPAPAP----------------
------------------------------AQAERQQTLGRMTLEEFLVRAGVVRED---
-----------------------------------MGGQTVVVPARAQALFPQGNVVAPT
MQVGNG--------------------VVHGVVGQ--GAGVPM--TVAAP-----------
TTPGVL-------------------NGFGKMEGGDLSSLSPVPYP--FDTVTRAR---KG
PT--------------VEKVVERR------------------------------QRRMIK
NRESAARSRQSKQAYIMELEA-EVAKLK-ENNEALQKKQVEML-----------------
--QKQKDEVIERIEKQL--GPKAKR-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------FCLRRTLTGPW
>gi|115467038|ref|NP_001057118.1|	   324 residues, 50 /line  Os06g0211200 [Oryza sativa (japonica cultivar-group)]
MELPADGSALARQGSIYSLTFDEFQSALGSAEKDFGSMNMDELLRNIWT-----------
-------AEESQAIAPAAAAASAAAVVGDA-----------QQQQQPIQRQGSLTLPRTL
SQKTVDEVWRDIMGLGGSDDE--------------DPAAAAAAA----------------
------------------------------APAQRQPTLGEMTLEEFLVRAGVVRED---
-----------------------------------MG-QTIVLPPQAQALFPGSNVVAPA
MQLANG--------------------MLPGVVGVAPGAAAAM--TVAAP-----------
ATPVVL-------------------NGLGKVEGGDLSSLSPVPYP--FDTALRVR---KG
PT--------------VEKVVERR------------------------------QRRMIK
NRESAARSRARKQAYIMELEA-EVAKLK-EQKAELQKKQVEMI-----------------
--QKQNDEVMERITQQL--GPKAKR-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------FCLRRTLTGPC
>gi|113367174|gb|ABI34644.1|	   330 residues, 50 /line  bZIP transcription factor bZIP50 [Glycine max]
------MAQLPPKIPN-M-TP---------NWPDFSSL----------HQKMPSLQT---
--------------TS--------SNQNPS------WVDEILEF--------------SV
ARR---------------------------------------------------------
----------------------------------------GAPRRSVSDSVTFLEAPLLD
HHHCKGGSVVGGGGGNNEFERFDDEQFMSMFS-DEALRNN------------------NN
------NNTMMAHTLSSSNPSTPSDHNS------------INDEKEMENKEEEEKKQLK-
------------NES---------EEDEDE-SQCKQE-ITQLPNNDDSKNNSNANAT--C
SS--------------EKITDPKR------------------------------VKRILA
NRQSAQRSRVRKLQYISELER-SVTSLQ-AEVS-VSPRVAFLD------HQRLLLNVDNS
AL-------KQRIAAL--AQDKIFK--------------DAHQEALKREIERLRQ-----
------VYHQQNIKKMD--------NA-AGSPPSQSPP----------------------
------------------------------------------------------------
-SPSPKPRCETH---TEKEQL----------IN-V
>gi|113367252|gb|ABI34683.1|	   225 residues, 50 /line  bZIP transcription factor bZIP57 [Glycine max]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------ITYLDSPVKC
------GGNKNNNNNENEFDKFDDEQFMSMFT-DEVVLSG--------------------
------VPLPPPTTLSSSNPSSPYDQNF------------INDEKEKKEEEEEHHHHHQ-
------------LKN---------EADEVE-SQCKQE-IMQLPN--------DTNTC--S
SS--------------ERITDPKR------------------------------VKRILA
NRQSAQRSRVRKLQYISELER-SVTSLQKAEVSVLSPRVAFLD------HQRLLLNVDNS
AL-------KQRIAAL--AQDKIFQ--------------DAHQEALKREIERLRQ-----
------VYYPQSLQKME--------NA---------------------------------
------------------------------------------------------------
-----------------------------------
>gi|147768650|emb|CAN71664.1|	   294 residues, 50 /line  hypothetical protein [Vitis vinifera]
-----------------------------------MAA----------PALLPAATA---
--------------TT--------TSQHPS------WVDEFLDF--------------SS
SRR---------------------------------------------------------
----------------------------------------GSHRRSVSDSIAFLEAPVLV
EEARHSHATML--HGANGFDRLDDDQLMSMFS-DDIS-----------------------
--------LTVPPTVSSSGPSTPSDQNS------------NNDEKGDEKGAALDQ--QP-
------------PKN---------EPGEVE-SSCKTE-LPSF----------RPSTA--S
NG--------------DSIIDPKR------------------------------VKRILA
NRQSAQRSRVRKLQYISELER-SVTSLQ-TEVSALSPRVAFLD------HQRLILNVDNS
AL-------KQRIAAL--AQDKIFK--------------DAHQEALKKEIERLRQ-----
------VYHQQSLKKMG--------NS-ATGAPPQSTT----------------------
------------------------------------------------------------
-QPHQTTTTDAAMGCTDKLQL----------L--N
>gi|147846478|emb|CAN81664.1|	   280 residues, 50 /line  hypothetical protein [Vitis vinifera]
-----------------M-AA---------NWPSFP------------HQKIPSMGN---
--------------LA------PPATQNPS------WVDEFLDF--------------SS
AKR---------------------------------------------------------
----------------------------------------GTHRRSVSDSIAFFEAPDDC
---RNSGAAPRPPGAGNEFDQFDDEQFMSMFT-DA-------------------------
----------MAPTISSSNPSTPSDHYS------------FNEEKTTTIEQQQQQ--QQ-
------------LKN---------ESEEVQ-SSCKLE-S---------QTPPQPSMT--T
SN--------------DRIVDPKR------------------------------VK----
-RQSAQRSRVRKLQYISELER-SVTSLQ-TEVSVLSPRVAFLD------HQRLLLNVDNS
AL-------KQRIAAL--AQDKIFK--------------DAHQDALKREIERLRQ-----
------VYHQQNLKTTE--------NA-A--PPTASD-----------------------
------------------------------------------------------------
---------VKD---FKEEDV----------LN-H
>gi|15230964|ref|NP_191371.1|	   329 residues, 50 /line  bZIP transcription factor family protein [Arabidopsis thaliana]
------MAQLPPKIPT-MTTP---------NWPDFSS------------QKLPSIAA---
--------------TAAAAATAGPQQQNPS------WMDEFLDF--------------SA
TRR---------------------------------------------------------
----------------------------------------GTHRRSISDSIAFLEPPSSG
-------------VGNHHFDRFDDEQFMSMFN-DDVHNNN------------------HN
HHHHHSINGNVGPTRSSSNTSTPSDHNS------------LSDDDNNKEAPPSDHDHHMD
NNVANQNNAAGNNYN---------ESDEVQ-SQCKTE-P----QDGPS--ANQNSGG--S
SG--------------NRIHDPKR------------------------------VKRILA
NRQSAQRSRVRKLQYISELER-SVTSLQ-TEVSVLSPRVAFLD------HQRLLLNVDNS
AI-------KQRIAAL--AQDKIFK--------------DAHQEALKREIERLRQ-----
------VYHQQSLKKME--------NN-VSDQSP---A----------------------
------------------------------------------------------------
-DIKPS---------VEKEQL----------LN-V
>gi|18491297|gb|AAL69473.1|	   311 residues, 50 /line  At2g42380/MHK10.10 [Arabidopsis thaliana]
-----------------M-TQ---------HWPDFSS------------QKLSPFSTP--
--------------TATAVATATTTVQNPS------WVDEFLDF--------------SA
SRR---------------------------------------------------------
----------------------------------------GNHRRSISDSIAFLEAPTVS
IE-------------DHQFDRFDDEQFMSMFT-DDDNLH-------------------SN
PSHINNKNNNVGPTGSSSNTSTPS--NS------------FNDDNKELPPSDHNMNN---
----------NINNN---------YNDEVQ-SQCKME-P----EDGTA--SNNNSGD--S
SG--------------NRILDPKR------------------------------VKRILA
NRQSAQRSRVRKLQYISELER-SVTSLQ-AEVSVLSPRVAFLD------HQRLLLNVDNS
AL-------KQRIAAL--SQDKLFK--------------DAHQEALKREIERLRQ-----
------VYNQQSLTNVE--------NA-NHL--SATGA----------------------
------------------------------------------------------------
-GATPAVDIKSS---VETEQL----------LNVS
>gi|92871553|gb|ABE80500.1|	   328 residues, 50 /line  Basic-leucine zipper (bZIP) transcription factor [Medicago truncatula]
------MAQLPPKVPIPNMTP---------TWPEFSS-----------HQKMPNLKTI--
--------------SPSNASNFSNNQQNPS------WVDEFLDF--------------SS
TRR---------------------------------------------------------
----------------------------------------GAHRRSASDSVTFIEASMME
HCR--------RRDGDNEFERFDDEQLMSMFSVDEVSRNN--------------------
-----TMMPPPATLSSNSNPSTPSDHNS------------INDEKEEDEEEKMQQKQ---
------------LKH---------ESDEDEIGECKQE-NGGVVNDEDD--NNGNTTT--F
SS--------------PKITDPKR------------------------------VKRILA
NRQSAQRSRVRKLQYISELER-SVTSLQ-AEVSVLSPRVAYLD------HQRLLLNVDNS
AI-------KQRIAAL--AQDKIFK--------------DAHQEALKREIERLRQ-----
------VYHQQQNIKNN--------AT-AAAVS--PSP----------------------
------------------------------------------------------------
-SPKPRCDNDTH---IENEHL----------IN-V
>gi|115440013|ref|NP_001044286.1|	   265 residues, 50 /line  Os01g0756200 [Oryza sativa (japonica cultivar-group)]
------MAQLPPKIPV-A-AP---------G---------------HHQHWASAGG----
-------------------------AGDAA------WADEFAEF--------------AA
SRR---------------------------------------------------------
----------------------------------------GAHRRSLSDSVAFVEVAP--
----------AGCGAGGEFDRLDDDQLMSMFP-DE-------------------------
-----------------GGSSAPGSDNG------------GSDSDGGG------DKHA--
---AAQ------SDD---------GQHAAG-EPT----------------QEQAAAT--S
PT--------------ELIRDPKR------------------------------VKRILA
NRQSAQRSRVRKLQYISELER-SVTTLQ-NEVSVLSPRVAFLD------QQRTILTVGNS
HL-------KQRIAAL--AQDKIFK--------------DAHQEALRKEIERLRQ-----
------VYQQQNTKLSG--------GL-AADHAHVHGG----------------------
------------------------------------------------------------
-P--PPVRAEKELM--------------------S
>gi|125581476|gb|EAZ22407.1|	   269 residues, 50 /line  hypothetical protein OsJ_005890 [Oryza sativa (japonica cultivar-group)]
------MAQLPPRAPS-A-AA---------A---------------AGQEWS--------
---------------------------AMA------AAGEFLGF--------------AA
ARR---------------------------------------------------------
----------------------------------------GAHRRSASDSAAFLMEAAVP
MDD-----VIVGVGGGGEFDRLDDEQLMSMFS-DV-------------------------
-----------------E---APAVSDG------------GGERGPAG------EAHLMD
MGDGDD------GMG---------ATSPAG-AGA----------------MAAAAAG--G
AA--------------DGIADPKR------------------------------VKRILA
NRQSAQRSRVRKLQYISELER-SVTTLQ-MEVSALSPRVAFLD------HQRSLLTVGNS
HL-------KQRIAAL--AQDKIFK--------------DAHQEALKKEIERLRQ-----
------VYHQQQIKATG--------GADIATAASMQAK----------------------
------------------------------------------------------------
-H--ELLACEGAAM--------------------R
>gi|125569494|gb|EAZ11009.1|	   279 residues, 50 /line  hypothetical protein OsJ_000834 [Oryza sativa (japonica cultivar-group)]
------MAQLPPKIPT-M-AT---------AWPEFGGGHHHHAAHGHHHQRSPSMGAFLA
APLPPFPLPPPAPANGGAQQQQQQQQHQPS------WVDEFLDF--------------SA
TKR---------------------------------------------------------
----------------------------------------GAHRRSQQPAAPA-------
------------------------------------------------------------
-----------------ASASSPSDHN--------------------------------S
MNDEKQ------DKG---------ETDEAQ-SEC----------------DGATPGQ--P
AS--------------PATVDPKR------------------------------VKRILA
NRQSAQRSRVRKLQYISELER-SVTSLQ-TEVSALSPRVAFLD------HQRSLLTLGNS
HL-------KQRIAAL--AQDKIFK--------------DAHQEALKKEIERLRQ-----
------IYHQQSLKNAE--------SQ-PADAAPVRGR----------------------
------------------------------------------------------------
-DNADLIGSEGAAAAAPCPH--------------S
>gi|113367256|gb|ABI34685.1|	   233 residues, 50 /line  bZIP transcription factor bZIP43 [Glycine max]
-MDLS-------------------------------------------------------
--------PSDPFAGGSSTASMEEIGSEDD------LFSTYIDVDKLGGA----------
------------------------------------------------------------
------------------------------------------------------------
-----------------------NGSGASG-NGADP----------TGETE----KSPAR
PRHRHS--------------------SS--------------------------------
-----VD------------------FGEIMDAKKA-----------------MPPDK--L
AE--------------LWTIDPKR------------------------------AKRILA
NRQSAARSKERKARYIQELER-KVQTLQ-TEATTLSAQLTLYQ------RDTTGLSTENT
EL-------KLRLQAM--EQQAQLR--------------DALNEALKKEVERLKV-----
------ATGEMMSHT-D--------SFNLGMHLMPFSGSNFVPIPA-QSGPSGHQNMQMP
------------------------------------------------------------
----------------------------------P
>gi|125601524|gb|EAZ41100.1|	   278 residues, 50 /line  hypothetical protein OsJ_024583 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
---------------MPQLCTRDWIPAAAP------LCASTC------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------PCRLD----------GCRLA----AATVL
QTAPRS--------------------CS--------------------------------
-----QDPGD-----RRPAPL---GCSNLPTCYFC-----------------LPP-----
-----------------CSVRRST------------------------------RRGILA
NRQSAARSKERKARYITELER-KVQTLQ-TEATTLSAQLTLFQ------RDTTGLSAENA
EL-------KIRLQAM--EQQAQLR--------------DALNDALKQEVERLKI-----
------ATGEMAKSN-D--------AYNTGMQQVPYSPS-FFQLSDQHAVQHHAGVQQLP
HQFQQPH---------PSVPSHQMLSHPNSLSDMMQQDSLGRLQGL----DIGKGPVAVK
NEAEVVVKSEGSSI--------------SAGGEGH
>gi|68565757|sp|Q6S4P4|RF2B_ORYSJ	   329 residues, 50 /line  Transcription factor RF2b
-MQEPKHTDP---------------------------AAMRGAHHRRARSEVAFR-----
-------LPDDLDLGGGGAGAFDEIGSEDD------LFSTFMDIEKIS------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------SGPAAAG-GSDRD----------RAAET----SSPPR
PKHRHS--------------------SS--------------------------------
-----VDGSGFFAAARKDAAA---SLAEVMEAKKA-----------------MTPEQ--L
SD--------------LAAIDPKR------------------------------AKRILA
NRQSAARSKERKARYITELER-KVQTLQ-TEATTLSAQLTLFQ------RDTTGLSAENA
EL-------KIRLQAM--EQQAQLR--------------DALNDALKQELERLKL-----
------ATGEMTNSN-E--------TYSMGLQHVPYNTP-FFPLA-QHNAARQNGGTQLP
PQFQPPR---------PNVPNH-MLSHPNGLQDIMQQDPLGRLQGL----DISKGPLVVK
SESSSISASESSST--------------------F
>gi|79317079|ref|NP_001030982.1|	   250 residues, 50 /line  DNA binding [Arabidopsis thaliana]
-MEKSDPPPVPKPGATIIPSS---------DPIPNADPIPSSSFHRRSRSDDMSM-----
-------FMFMDPLSSAAPPSSDDLPSDDD------LFSSFIDVDSLTSN----------
------------------------------------------------------------
------------------------------------------------------------
-------------------PNPFQNPSLSS-NSVSG----------AANPP---PPPSSR
PRHRHS--------------------NS--------------------------------
-----VDAGCAMY------------AGDIMDAKKA-----------------MPPEK--L
SE--------------LWNIDPKR------------------------------AKRILA
NRQSAARSKERKARYIQELER-KVQSLQ-TEATTLSAQLTLYQ------RDTNGLANENT
EL-------KLRLQAM--EQQAQLR--------------NALNEALRKEVERMKM-----
------ETGEISDAF---------------------------------------------
------------------------------------------------------------
-----------------------------------
>gi|115487474|ref|NP_001066224.1|	   328 residues, 50 /line  Os12g0162500 [Oryza sativa (japonica cultivar-group)]
-MDGRFPLPPASGG--------------------------GRGHHRRAHSETFLR-----
-------LPD---ADLLLDPEGDFSFSDLD------FPSLSDDSP-AISD----------
------------------------------------------------------------
------------------------------------------------------------
-------------------PTPPPPPPMAA-TP----------------AP---APRPPG
GAHMRS--------------------LSLDTAFFEGFSLQG-GGG--GGGGGGSGGSGGH
KRSGSMDGVNSPF--EGESAL---SGGLPDYAKKA-----------------MPAER--I
AE--------------LALIDPKR------------------------------AKRILA
NRQSAARSKERKIKYTSELER-KVQTLQ-TEATTLSAQLTLLQ------RDTSGLTAENR
EL-------KLRLQSM--EEQAKLR--------------DALNEALREEVQRLKI-----
------AAGQAPNMNGN--------PFNGGLQQ-QIPPY-YTQQQQQQQQMPYLGGH---
-HAQQRH---------PS-HQQSSSNGGQSLSGQSLNDSMD----------FM-------
-----------------------------------
>gi|7258340|gb|AAF37279.4|	   261 residues, 50 /line  VirE2-interacting protein VIP1 [Arabidopsis thaliana]
-MSVDSEET---------------------------------------------------
----------------------------------------SSNGV-VPP-----------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------N-SL----------------PP---KPEARF
GRHVRS--------------------FSVDSDFFDDLGVTE-EKFIATSSGEKKKGNHHH
SRSNSMDGEMSSASFNIESILASVSGKDSGKKNMG-----------------MGGDR--L
AE--------------LALLDPKR------------------------------AKRILA
NRQSAARSKERKIRYTGELER-KVQTLQ-NEATTLSAQVTMLQ------RGTSELNTENK
HL-------KMRLQAL--EQQAELR--------------DALNEALRDELNRLKV-----
------VAGEIPQGNGN--------SYNRA------------QFSSQQSAMNQFGNK---
-----------------T-NQQMSTNGQP-----SLPSYMD----------FTKR-----
----------------------------------G
>gi|113367276|gb|ABI34695.1|	   330 residues, 50 /line  bZIP transcription factor bZIP21 [Glycine max]
LVKRETPWDRGVEN----------------------------------------------
--------NNNNNVEGSGEKKSPEGEVVDD------LFSAYMNLDSFDALNSS-------
----------------------GTDDKNGGENRDDLDSRASGTKTNG-GDSSDNEAESSV
NES---------------------------------------------------------
-----------------------GDGGVRQGGNEKR----------EGMKRSAGGEIAPT
TRHYRS--------------------VSMDS-FIGKLNFDEESPKLP-PS--PGQRSALM
SPAGGIDGNSAA--FSLEFGN---GEFSGPELKKI-----------------MANEK--L
AE--------------IALIDPKR------------------------------AKRILA
NRQSAARSKERKMRYISELEH-KVQTLQ-TEATTLSAQLTLLQ------RDSAGLTNQNS
EL-------KFRLQSM--EQQAKLR--------------DALNEALTAEVQRLKL-----
------ATAELSGD-----------SHGSGCLI-P------------------QHSVNPL
MFQQQQQ---------PPTASQ--------------------------------------
----------------------------------Q
>gi|125562411|gb|EAZ07859.1|	   320 residues, 50 /line  hypothetical protein OsI_029091 [Oryza sativa (indica cultivar-group)]
---MDDP-----------------------------------------------------
----------------------------------------------GAADPGA-------
-----------------------------RPHHLSPGQPPVVPRSPTPLDLSSAAAAAAA
ASYRR-------------------------------------------------------
----------------LSPSLRPPAHPQARLPSPYP----------QIPSSSSAAAAGSS
GHHARS----LSQPLFFSLDSLPPLPLSVDS-FIEKLNFDE-SPKLPLPS--PSG-GLSR
SGSGSLDGGAASL-FGAEFAN---GEFTEAEKKKI-----------------MANER--L
AE--------------IALTDPKR------------------------------VKRILA
NRQSAARSKERKMRYIQELEH-KVQVLQ-TEATTLSAQLTMLQ------RDSTGLATQNN
EL-------KIRLQAM--EQQAQLR--------------DALNEALTAEVQRLKL-----
------ATGEITDG-----------RMSKGLQQ-QMNSQ-LIQLQQLQIQ--QQQSSQTT
QQGQQQQ---------PQKS----------------------------------------
----------------------------------A
>gi|42408548|dbj|BAD09726.1|	   221 residues, 50 /line  putative vsf-1 protein [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
----------------------------------------------MEALNSS-------
-----------------------------EERHEDRDSRASGTRTGSVADSSENEAESHS
TPVER-------------------------------------------------------
----------------KD--------------------------------------GGGK
SRHCRS--------------------LSVDS-FIEKLNFDE-SPKLPLPS--PSG-GLSR
SGSGSLDGGAASL-FGAEFAN---GEFTEAEKKKI-----------------MANER--L
AE--------------IALTDPKR------------------------------VKRILA
NRQSAARSKERKMRYIQELEH-KVQVLQ-TEATTLSAQLTMLQ------RDSTGLATQNN
EL-------KIRLQAM--EQQAQLR--------------DDK------------------
-------------------------FVSKSFPS-FLSWR---------------------
------------------------------------------------------------
-----------------------------------
>gi|115441173|ref|NP_001044866.1|	   323 residues, 50 /line  Os01g0859300 [Oryza sativa (japonica cultivar-group)]
---------------SMNMD---------------------EFVANIWN-----------
-------AEEFQATTGGCKGAMEEAKVVDS------GSGSGDAGGSGLCRQGSFSLPLPL
CQKTVEEVWTEINQ-APAHTSAPASA--------LQPHAGSGGV----------------
------------------------------AANDRQVTLGEMTLEDFLVKAGVVRGS---
----------------FTGQAA---MGSGMVNGPVNPMQQGQG-GPMMFP------VGPV
NAMYPV--------------------MGDGM-GY-PGGYNGM--AIV-PPPPPAQGAMVV
VSPGSS-------------------DGMSAMTHADMMNCIGNGMMI-ENG-TRKRPHRED
GC--------------AEKTVERR------------------------------QRRMIK
NRESAARSRARKQAYTVELEA-ELNYLK-QENARLKEAEKTVL-----------------
--LTKKQMLVEKMMEQSK-------------EKMNANR----------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------GGSQLRRSGSCMW
>gi|92090805|gb|ABE73182.1|	   272 residues, 50 /line  ABA response element binding factor [Avena fatua]
------------------------------------------------------------
------------------------------------------------------------
-------VWAEINKEAPAHAAHAQAAQALPQPPVRPPAVNGGGI----------------
------------------------------AENDRQGTLGEMTLEQFLVKAGVVRGS---
----------------LGGGQAPPPMPVGMVHGPMHPMQQGQQPGPLMYQ------VAPV
NAMYPG--------------------MGDGM-GFVPNGYTGI--AVV-PPPAPSQGGVGI
VSPGSS-------------------DGRSAMTQADAMNCIGSGAMVVENGAARKRPAPED
RP--------------GEKSVERR------------------------------HRRMIK
NRESAARSRARKQAYTVELEA-ELNELK-EENARLKAEETTIL-----------------
--LARKQMLLEKMMEQSK-------------ENAKAKK----------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------GGARPRRCGSCIW
>gi|115445455|ref|NP_001046507.1|	   298 residues, 50 /line  Os02g0266800 [Oryza sativa (japonica cultivar-group)]
-MKK--------CPSELNFE---------------------AFFHG--------------
------------------------------------------------------------
---------------------------------------------ER-GEDDADAAADQ-
--------KPGGGPHPPPFAMFSA--ADLSSFGFADS-----------------------
------------------------------VTSTITGVIPNHIWP---------QSQSLN
ARHPAV--------------------YTIES-QSSICAAA--------SPTSATTLNMKE
SQTLGG-------T---------------------SGSDSDSESLLDIEGG------PCE
QS--------------TNPLDVKR------------------------------MRRMVS
NRESARRSRKRKQAHLADLET-QVDQLR-GENASLFKQLTDAN------QQFTTAVTDNR
IL-------KSDVEAL--RVKVKMAEDMVA--------RGALSCGLGHL-----------
--------------------------------------G-GLSPALNPRQGACRVPD--V
LT------------------------GLDY----AGDDPFTGLSPP----EQVQMPGGG-
-----EVGDAWGWDNHSNGAM------------SK
>gi|115446551|ref|NP_001047055.1|	   326 residues, 50 /line  Os02g0538900 [Oryza sativa (japonica cultivar-group)]
-MSRSP--HLPPRCPP-------------------------------LGPQITRR-----
-------DDSLFTQSCRFPSEDPFVGEPPC------WLDDLLADSGKS---------H--
------------------------------------------------------------
--------------------------------------TLPPLRRACSDSDAILDVLTSF
-----------------------------------------------QSPIYPIDEGDPQ
PVGEAG--------------------ESFNA-AAEGGGS-------G-AGIEGSCVYGPN
SPRQKT-------RLTSSESS---MVNAV-------------------------------
LE--------------NVPSNPLQYLMIDATSGVNCNVGAANGTGDTGDAVCHADQEKSL
KRRSGQRSRVRKLQYIADLER-TVDSLQ-NIGADLAVRVASLF------QLRNALSMENK
QL-------RRQITSL--QQAKLIK--------------DGQTQMLKKETERLKQ-----
------LSVRHRRSRSV--------TSC--------------------------------
------------------------------------------------------FEANSF
GGGDPSAI-NWQMLDMSKLSLNGGAVVPPRGGYGM
>gi|115474165|ref|NP_001060681.1|	   274 residues, 50 /line  Os07g0686100 [Oryza sativa (japonica cultivar-group)]
--MGVHAMSCHGGGGGGGEG---------------------ALSRQGSVYS---------
-----------------------------------------LTLNEVE---------SHL
GEPLRSMNLDDL-------------------LRTVLPAAAAAAETAG-RKTVDEVWRDIQ
GAS---------------------------TGRHHATPMGEMTLED--------------
------------------------------------------------------------
FLSRAG--------------------VAVDG-AASAAGAHWLRGHYP-PPPPPTTTTLQY
VGGSGA-------------------VVDGVYNRVDGHGVAGFLS--QVGVAGRKRGGGVD
GV--------------VEKTVERR------------------------------QKRMIK
NRESAARSRARKQAYTNELEN-KISRLE-EENQRLREHKAVAD------FSTFPSCVD--
----------------------------------------FLKAFLTQKLEPVMQ-----
------IVPQPEPKQQL-------------------------------------------
------------------------------------------------------------
---------------------------RRTTSASF
>gi|125528502|gb|EAY76616.1|	   278 residues, 50 /line  hypothetical protein OsI_004463 [Oryza sativa (indica cultivar-group)]
----MASRVMASSSPSHTAS---------------------DIAR---------------
---------FAAVRGGGGSAGLGSMNVEEI------LRGIYADMPTPA---------LPL
---------------------------------VGGDRPMSPLPAPD-VAAAPRTAEEV-
-----------------------WKEITGAGVAAA-------------------------
--------------------------------------AGGVVPPAAAAAAAPAVVAG--
------------------------------------------AG----AGTGAEMTLEDF
LAREGA-------VKEDEAVV---TDPSAAKGQVVMGFLNGAE-VTGDVTGGRSRKRHLM
DP--------------MDRAAMQR------------------------------QKRMIK
NRESAARSRERKQAYIAELES-LVTQLE-EENAKMFKEQEEQH-------QKRLKEPSYR
NM-------QYRTQYW--LKEMVVP--------------VIIRKTSARDLRR--------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------TNSMEW
>gi|125532749|gb|EAY79314.1|	   278 residues, 50 /line  hypothetical protein OsI_033273 [Oryza sativa (indica cultivar-group)]
-MEAGGGWALPGCGGAGDVD---------------------LLNAYMSLEG---------
------------------------------------------------------------
-----------MG-------------GADGLNNSDGDSRGSSMRTNG-ADSSENESEDYV
GADSQALLWGGAGGGEAAG-----------------------------------------
------------------------------------------------KKRRNNAAGETA
ARHARS--------------------LSMDS-LMGK------------------------
------------------------------------------------------------
-------------------------------------LSFAANGEPAKFSLEFGSGEVLA
NRQSAARSKERRMRYIAELEQ-KVQILQ-TEATTLSAQLTLLQ------RDSSGMATQNN
EL-------KFRLQSM--EQQAQLR--------------DALNEALTAEVQRLKL-----
------AANEVGDTSSS--------S--------------NLAHQIQLRCQNQMLDL--H
KQQQQQV---------EQIPFYQLEQ----------------------------------
-------------PEQQNGTA------RNHES--K
>gi|125576613|gb|EAZ17835.1|	   248 residues, 50 /line  hypothetical protein OsJ_032044 [Oryza sativa (japonica cultivar-group)]
-MGGGGGGGQAAPWGGVQEY---------------------YAKPSSF------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------GRHQGRPWEQGMNNLVNYRQSGGP-
------------------------------------------------------------
----------------------------------PMPAKEKVGG----HHGSPSVLRDHD
-HGMDR-------RSSDESGH---DQKVGPERKEG-----------------VPPKH--A
Q----------------SEADTKR-----------------------------------A
KQQYAQRSRVRKLQYIAELER-KVQALQ-SEGIDVSAEMEFLS------QQNIMLDLENK
AL-------KQRLESL--AQEQLIK--------------RFQQEMFEREIGRLRS-----
------LYQQQQQQQKQ--------PQPTTTLSRS----------NSRDLDSQFA-----
---------------------------------------NLSLKHK----DPNSGPL---
---------------------------RTQSSSIL
>gi|125606331|gb|EAZ45367.1|	   315 residues, 50 /line  hypothetical protein OsJ_028850 [Oryza sativa (japonica cultivar-group)]
-----------------MFL---------------------DLEKLNSTFRASSE-----
-------AEADSSSAGAAAA----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------VAAADDNNAHGAR
PKHQHS--------------------LSMDE-SMSIKAEELVGA----SPGTEGMSS---
-----------------------------AEAKKA-----------------VSAAK--L
AE--------------LALVDPQEGEK--------QMLHCLCEFLVGGDYYLREETLIWA
NRQSAARSKERKMRYIAELER-KVQTLQ-TEATTLSAQLALLQ------RDTSGLTTENS
EL-------KLRLQTM--EQQVHLQ--------------DALNDTLKSEVQRLKV-----
------ATGQMANGGGM--------MMNFGGMPHQFGGN-QQMFQNNQAMQSMLAAH--Q
LQQLQLH---------PQAQQQQVLH-PQH----QQQQPLHPLQAQ----QLQQAARDLK
MKSPMGGQSQWGDG-------------KSGSS-GN
>gi|15224966|ref|NP_178956.1|	   262 residues, 50 /line  transcription factor [Arabidopsis thaliana]
-MNGSDNSTP-------------------------------------SRPRSITQ-----
----------------------------PS------LAFSSLPP----------------
------------------------------------------------------------
-----------------------------------LSPSPSSSRRNSIPLM--NPSASV-
----------------------------ESRDSSIRVKKKSLLPPLCVKRRAPKDDIEPF
KRHYRS--------------------LSVDS-CLS----DLLKL----PPSPNNVSSSRS
VDGEQN-------ASELEFDT---SVYTDDELNKI-----------------AKSTK--L
-K--------------EVASDPKE------------------------------VRRILK
NQESAARSKQKKLQYMINLEL-KINFLE-NKNASIFEKIKLLE------NDKTMRMNEKK
EI-------MIRIESL--EQHAELR--------------DALTEHLHVEIERLKA-----
------VLISNEKGNEK--------SPKSR------------------------------
------------------------------------------------------------
---DDNM----------------------------
>gi|4432796|gb|AAD20648.1|	   294 residues, 50 /line  putative VSF-1-like b-ZIP transcription factor [Arabidopsis thaliana]
-MNGSDNTTP-------------------------------------SRPWSITQ-----
----------------------------PS------LAFSSLPP----------------
------------------------------------------------------------
-----------------------------------LSPSPSSSRRNSLPLM--NPSTSM-
----------------------------ESRDSSMRFKKNSLLPPLGVKKIAPK-DIGPL
KRHYRS--------------------VSMDS-CLS----DLLKL----TPSPGNTPSSRL
VDGDQN-------ASRLEFDA---NDYTDDELNKI-----------------AKSNK--L
-K--------------EVALDPKE------------------------------VRRILK
NRESAAHLKQKKLQYMINLEH-RINFVE-NENASIFEKIKLLE------NDKTMMMNEKK
EI-------MIRIESM--EIQAQLR--------------DVLTEHLHGESERLKA-----
------ALISNENGNGK--------VQKLRMATCEVLQ----------------------
--NR------------------------------------------------HEFDKSNM
EVMDSNMI-NWSQPNPGFN---------------G
>gi|15235683|ref|NP_195487.1|	   305 residues, 50 /line  bZIP transcription factor family protein [Arabidopsis thaliana]
-MTQKLFIQ-------YSLR---------------------SYI-----VFWKYD-----
-------QITPWFVHKYQAPTMQFFPFPLL------ISLISLL-----------------
-EKLLAIMLST------------------------------APAFSF-SE----------
---PGLVNQFSGFQTGFTPWEWDCSDLFFVDQMSLEPAIPSPCYGESDTGSVKINSG---
---------------------SHDMKTGSDESCAGFVKI----NPR--------------
------------------------------------------------------------
CDDADI-------SNDLPCS-----QADEPDSDDTKQLTAITNFGSGENNHNRKKM----
IQ--------------PEMTDERK------------------------------RKRMES
NRESAKRSRMRKQSHIDNLRE-QVNRLD-LENRELGNRLRLVL------HQLQRVNSDNN
RLVTEQEILRLRLSEM--RRILIIR--------------QLQQQQ-QWELHNRRM-----
------IMTEQN------------------------------------------------
------------------------------------------------------------
------------HPHL------------------Q
>gi|18420842|ref|NP_568457.1|	   277 residues, 50 /line  BZO2H2 (basic leucine zipper O2 homolog 2); DNA binding / transcription factor [Arabidopsis thaliana]
-MDNHTAKD------------------------------------IGMKRSASEL-----
-------ALQEYLTTSPLDPC------------------------------------FDL
MNRDYTCELRD-------------------------------------------------
------------------SLLWS-EGLF----------PAGPFRDAQSSICENL------
----------------------SADSPVSANKPE--------------------------
------------------------------------------------------------
----------------VRGGV---RRTTSGSSHV---NSDDEDAETEAGQ------S--E
MT--------------NDPNDLKR------------------------------IRRMNS
NRESAKRSRRRKQEYLVDLET-QVDSLK-GDNSTLYKQLIDAT------QQFRSAGTNNR
VL-------KSDVETL--RVKVKLAEDLVA--------RGSLTSSLNQLLQ---------
------THLSPPSHSIS--------SLHYTGNTSPAIT----------------------
--VHSDQ---------SL-FPGMTLSGQNS----SPG------------------LGNVS
SEAVSCVSDIWP-----------------------
>gi|2104677|emb|CAA66478.1|	   322 residues, 50 /line  transcription factor [Vicia faba var. minor]
----MEG----LATGSNERN---------------------ELVRVRHGSDSGSK-----
-------PVTN-LNGQFCQICGDTIGLTAA------GGVF-VACHECA---------FPL
CHPCYEYEIKNVS-------------QLCPQCKTRYKTHKDGPQVKG-D-DDEDDVDGL-
---RNEVKY-GPGNNSKTGWQWD-EDADLSSSSGHDSQLQNPHLTNGQLMSGEIACA--T
SD-------------TQSAQTTSGPLGQSGNVHSRPYA-DPKQPGL--------------
------------------------------------------------------------
ESDEEM-------RRVPDMGG---ESAGTSASHKGTGSTAGPERAQGTGEGQKKRG----
RS--------------PADKESKR------------------------------LKRLLR
NRVSAXQARERKKAYLSDLET-RVNDLE-KKNSELKEKLSTLQ------NENQ-------
ML-------RQILKNTTAS-------------RRGGNSGTN-------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------NAE
>gi|2934884|gb|AAC05017.1|	   326 residues, 50 /line  TGACG-motif binding factor [Glycine max]
-MERSGG----MVTGSHERN---------------------ELVRVRHGSDSGSK-----
-------PLKN-LNGQICQICGDTIGLTAT------GDLF-VACHECG---------FPL
CHSCYEYELKNVS-------------QSCPQCKTTFTSRQEGAEVEG-DDDDEDDADDL-
---DNGINY-GQGNNSKSGMLWE-EDADLSSSSGHDSHIPNPHLVNGQPMSGEFPCA--T
SD-------------AQSMQTTSDPMGQSEKVHSLPYA-DPKQPGP--------------
------------------------------------------------------------
ESDEEI-------RRVPEIGG---ESAGTSASRPDAGSNAGTERAQGTGDSQKKRG----
RS--------------PADKESKR------------------------------LKRLLR
NRVSAQQARERKKAYLIDLET-RVKDLE-KKNSELKERLSTLQ------NENQ-------
ML-------RQILKNTTAS-------------RRGSNSGTN-------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------NAV
>gi|21592919|gb|AAM64869.1|	   273 residues, 50 /line  unknown [Arabidopsis thaliana]
-MENNISPP---------------------------------------------------
----------NNMHHHSASLDDLFTEDQPA------WLDELLSE--------------PA
SPK---------------------------------------------------------
--------------------------------------INKGHRRSASDTAAYLNSALMP
SK-------------ENHVAGSSWQFQNYDLWQSNSYE-QHNKLGW--------------
------------------------------------------------------------
DFSTAN-------GTNIQRNM---SCGAL-----NM-SSKPIEKHVSKMKEGTSTKP--D
GP--------------GSKTDSKR------------------------------IK----
-HQNAHRARLRRLEYISDLER-TIQVLQ-VEGCEMSSAIHYLD------QQLLMLSMENR
AL-------KQRMDSL--AEIQKLK--------------HVEQQLLEREIGNLQF-----
------RRHQQQPQQNQ--------KQV--------------------------------
----------------------------------------------------QAIQNRYN
KYQPP----VTQEPDAQFAAL------------AI
>gi|22326603|ref|NP_196104.2|	   307 residues, 50 /line  bZIP protein [Arabidopsis thaliana]
---MSRPAPLPPRCPIPKKL---------------------SLSPVADTFYSSSS-----
-------PIESYIGQYKSSTQDSRLEDQPA------WLDELLCDKTDG----------LL
TRG---------------------------------------------------------
----------------------------------------GPLRRSASDSVVLLGDI--S
AT-------------FSGFDQSEDEESLSSEACGDLES-ACVYGPN--------------
------------------------------------------------------------
SPRAKN-------NSSFSNNP---IASAFSDYGSQT-PPQNLDDTVK-------GIN--R
SP--------------VAENACGS------------------------------MGIPNA
KRNPGQRSRVRKLQYIAELER-TVGMLQ-TVEADLSVRVASLL------QTRATLSLENS
QL-------KQQMAIL--KQDKLIR--------------EGEYQLLKKEAQRLKS-----
------GLGYLGSTNNS--------NRLVRSY---SA-----------------------
--------------------------GSNV----APRTASS-------------------
--------------HLDWNLL------DLTKLNLN
>gi|28317383|tpe|CAD29861.1|	   234 residues, 50 /line  TPA: putative basic leucine zipper transcription factor [Arabidopsis thaliana]
---------MLSSAKHNKIN---------------------NHSAFSISSSSSSL-----
-------STSSSLGHNKSQVTMEEVWKEIN------LGSLHYHRQL-------------N
IGH---------------------------------------------------------
----------------------------------------EPMLKNQNPNNSIFQDF--L
NM-------------PLNQPPPPPPPPSSSTIVTALYG-SLPLPPP--------------
------------------------------------------------------------
ATVLSL-------NSGVGFE-----FLDTTENLLAS-NPRSFEESAKFGCLGKKRGQ---
DS--------------DDTRGDRR------------------------------YKRMIK
NRESAARSRARKQAYTNELEL-EIAHLQ-TENARLKIQQEQLK----------IAEATQN
QV-------KKTLQRS--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------STAPF--------------------
>gi|83816991|ref|NP_001033032.1|	   261 residues, 50 /line  X-box binding protein 1 [Takifugu rubripes]
------------------------------------------------------------
----------MVVVTAGTGGAHKVLLISGK------Q-----SGSSGG---------SQP
------------------------------------------------------------
------------------------------------------------------------
----------------------GFSRPISVVLPS---------ATS--------------
------------------------------------------------------------
H------------------------------------TSSDSDSNSSAGPPVRKRQR--L
TH--------------LS-PEEKA------------------------------LRRKLK
NRVAAQTARDRKKAKMGELEQ-QVLELE-MENQKLHIENRLLQ------EKTSGLLAENE
EL-------RQRLSLDTIDSKDEVQCLLSTGKEAGLGVGSSESAALRLRVPPQQV-----
------QAQQLLNLKTS--------QWIQAVL---I------------------------
---LQTL---------SLICFWAFWTSLTQ----SCSSDLVSRSRR------CSWSEGGT
QYLPPHLR-LWGPHQLSWRPL------------MN
>gi|125589570|gb|EAZ29920.1|	   252 residues, 50 /line  hypothetical protein OsJ_013403 [Oryza sativa (japonica cultivar-group)]
-----------MEGEPSCRL---------------------SLLDRCGD-----------
--------------GSENPVVPPRVPSILN------LASHKCLDQSKF---------LPL
IHP---------------------------------------------------------
----------------------------------------APAHFTSSTVSALSPC----
-----------------------SEPPLSASMRQMVVK-ASPLPNV--------------
------------------------------------------------------------
K--------------------------------------FTEDDKKKVVA----DKF--L
SE--------------IVLTDPRR------------------------------DPEQSI
IC---RKVKGEKDEVYRGASTQILGVAV-GDCYIMSTSGNDAGMLLEGVRNNNGLVSLNN
EL-------KTRLQAM--DQQAQWG--------------DALTARLTAEAEHPRV-----
------VVGEISD--------------PHVPS---GSH----------------------
-----------------------------Q----QQSSYMDKLQQL----LTQRQPSQTQ
QNQPQ------------------------------
>gi|92896843|gb|ABE93371.1|	   308 residues, 50 /line  cAMP response element binding (CREB) protein [Medicago truncatula]
-----------MATTESDLD---------------------EFLNLDYEFRYPSL-----
-------ADTEAFMTGVCSAAFQTLLLPDV------VSSFSTWWWTNK---------LPK
LYS---------------------------------------------------------
----------------------------------------QTLHHHCFSVIYLWHCL--T
FW-------------IELIAYGAVGSPVSANKPNSREN-HIKGTAS--------------
------------------------------------------------------------
G------------------------------------SSDPSDEDNESGP----CEQ--I
TN----------------PVDMKR------------------------------QRRKDS
NCESARRSRWRKQAHLSELEA-QVEKLK-LENATLYKQFTDTS------QQFHEADTNNR
VL-------KSDVEAL--RAKVKLAEDMVT--------RSSFTTSLNNQFLHNQC-----
------QMSTPPQLNIR--------RMPHVSP---TIN----------------------
--FQQGN---------SASYGGVAV-GVHN----SNLAGFGNLDMT----YNDVVDNGVL
SNAMSCVT-IWP-----------------------
>gi|109093733|ref|XP_001103095.1|	   251 residues, 50 /line  PREDICTED: similar to X-box binding protein 1 isoform 1 [Macaca mulatta]
-MVVVAAAPSP-------------------------------------------------
-----------------ADGAPKVLLLSGQPASAAGA-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------PAGQALPLMVPAQR----------------------------------
--------------------------------------GASPEAASGGLPQARKRQR--L
TH--------------LS-PEEKA------------------------------LRRKLK
NRVAAQTARDRKKARMSELEQ-QVVDLE-EENQKLLLENQLLR------EKTHGLVVENQ
EL-------RQRLGMD--ALVAKEEAE--------------------AKGNGVRPVAGSA
ESAV----------QAQLSPLQNISPWILAVL----------------------------
--TLQIQ---------SLISCWAFWTTWTQ----SCSSNALPQSLPAWRSSQRSTQKDPV
PYQPPFLC-QWGRHQPSWKPLM------------N
>gi|47575714|ref|NP_001001199.1|	   252 residues, 50 /line  x-box binding protein 1 [Xenopus tropicalis]
-MVVV-------------------------------------------------------
-------------------GAPKVIFIPGNQCEQVDA-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------LGSVMLPLSSPS------------------------------------
----------------------------------------SPESVSNELPP-RKRQR--L
TH--------------LT-PEEKA------------------------------LRRKLK
NRVAAQTARDRKKARMSELEQ-QVVDLE-MENEKLLLENQLLR------EKSHSLLTENQ
EL-------RQRLGLS--TLEVKKEEE--------------LQELNQSRKDKVRPETGSA
ESAALRLCAPLQQEQAQMSPNLTVSTWILTAL----------------------------
--TLQTL---------SLISCWAFWKAWTQ----TCCLPMKKHSLEA--QMKRSTEKSLI
PYPPPHLL-LWGPHQPSWRPLM------------N
>gi|140041098|gb|ABE94298.2|	   323 residues, 50 /line  NAD, putative [Medicago truncatula]
-MEISNSLPNF-------------------------------------------------
-----------------QDHQLPPKISNSSRYDEICLKERLMSELGNEG-----------
------------------------------------------------------------
--------------------------------------GIRRHQRTYSDSMLSEQQQQE-
-------------VPCWLKDLLDD------------------------------------
------------EEDQKQPSTVC-SN----------------------------------
--------------------------------------KTHRRSSSDSLAYLNNKTI--L
QHSPERKVVDSQPSFLQQ-HHSRS------------------------------DHSKRG
KRNSGQQHRARKAQYIGELER-SVQALQ-AEGYEVSAELEFLD------QQNLILGMENR
AL-------KQRLDSL--SQEHFIKCL--------------EQEVLEREITRLRN-----
------LYQQQQHKQHQQ---SSNNKRIMASC----------------------------
--ILPLVLHEIGAYGLVRINMELFFHAHSI----FCPWLMILGSTQI--IYAASTSFVMI
DYVFFILT-KWAEWISQCQKYS------RFSLSYR

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.