Fandom

Proteins Wiki

At2g11810.1/MSA

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|18397057|ref|NP_565352.1|	   465 residues, 50 /line  MGDC (monogalactosyldiacylglycerol synthase type C); 1,2-diacylglycerol 3-beta-galactosyltransferase [Arabidopsis thaliana]
---------MMKVVSPRTRSDSITEKVFRRVY--SNF----------NISTVEDEYI---
-----------------HRQRSS---------------------DYEKESRLRK------
--------RG-----------------------LED------------KEEVMEMEQ-MG
AERIKTVLILMS-DTGGGHRASAEAIRDAFKIEFG-----DDYRIIIKD-VWKEYTGWPL
--NDMERQYKFMVKH-VGLWSVAFHGT---S--PKWIHKSY--LSALAAYYAKEIEAGLM
EY--KPDIIISVHPLMQHIPLWVMKW---QGLH--------------------KKVIFVT
VITDLNT-CHR-TWFHHGVSRCYC-PSKEVAKRALVDGLDDSQI-RVFGLPVRPSFP-RT
I----------LNKNELRKELEI---DLNLP-AVLLMGGGEGM-GP-VQKTALA------
LGDSLYNSKESNPIGQLIVICGR--NKVLAS--------------TLAS-HEWK----IP
VK--VRGFETQMEKWMGACDCIITKAGPGTIAEALICGLPIILN---DYIP-GQEKGNVP
YVVDNGAGVFTRS-PK------ETAKIVADWFSN--NKE-ELKKMSENALKLSQPEAVFD
IVKDIHHLS---------------------------------------------------
---------------------------------------QQQQRIPLFNEFS--------
--------------Y
>gi|106893336|ref|ZP_01360462.1|	   386 residues, 50 /line  UDP-glucuronosyltransferase [Clostridium sp. OhILAs]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------M
KRDRYKVMIMTA-SVGLGHDQAANAIKKNLLNKY------HNVDIEIVD-FIEIFPSYLG
--GIIKSTYLKMIDIVPSWYNILYQGTTN-----LNRSSKV--TSIFAYKYIKKIREVIE
AS--NPDMILFTNPFPSTLVSHL----KRKNKI---------------------NIETAT
VITDYT--VHG-VWIDPTIDHYFV-GSNILKQEMISKGVEGSKI-HATGIPIDTKFSAPV
------------DRESVLSDLGL---HKDLP-TVLIMGGGLGL-GS-MEEILET------
TDSV-------DRMLQIIIVAGK--NQVLMN--------------SLEN-RPYN--TKHH
VK--VLGFCENIHELMDVSHLLISKAGGLTMTEAISKELPVLVF---DPIP-GQEVKNAQ
YFSDIGAAMYLKD-LK------ELRNSIEELLF---INPEKREKMVKCCATIKKLDGAED
ISKIIVENMSQ-------------------------------------------------
-----------------------------------------MYYRDLFF-----------
--------------L
>gi|111219999|ref|YP_710793.1|	   427 residues, 50 /line  Putative glycosyl transferase [Frankia alni ACN14a]
--MAAPATRPSAEGRPAGV-----------------------------------------
------------------------------------------------------------
---VSAVERLGDGGAPDRGGPVIDGVAVEEAATAALLA-------------GAASRQ--P
ATRRGSALLLSG-SLGMGHDVMAEACGASLTRR--------GFTARTADS-LRMLGGRNG
--SRGEKVFRGMI-AVPGLYDAVHFSQMRT---GGRLALAI--ERASSRYVVPALRQELT
EQ--PTDLVISIFATGAAATSRV----KPEFP----------------------GLVTAV
FSTDCC--VHR-LWVHDNTDLYLV-TSQ-TAARYVRRFAPNALV-SVVPTPVREPFYDP-
-----------PTQEEARAALGI---PADAP-CVLLMSGSWGL-GP-LVEGAAA------
MAA---------AGIYVLAVAGR--NKPLAA--------------RLTA-LAER---QHK
VI--PFGFTDRIPALMAASDLVVTSSGD-TCSEARVIGRDLLLI---DVVP-GHGRDNLQ
KELERGHAEVTNT-DPVSLTRS--ALACLDRVKP----PSDRVAIGPQAWEQAFGSALAQ
IGFGAH------------------------------------------------------
------------------------------------------------------------
--------------W
>gi|68233465|ref|ZP_00572585.1|	   417 residues, 50 /line  similar to UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Frankia sp. EAN1pec]
----MVSGEPAATRGDCAV-----------------------------------------
------------------------------------------------------------
---DRGSRRLRD--------LIGMSVSKMDGIEGIMDD-------------VTAESE--P
ESRRGNVLLLSG-SLGMGHDVMAEACATSLERR--------GFHTRTADC-LRMTDGRNG
--TLGQNAFRGLI-AVPGVYDALHFSQLRT---GGRVARAI--ERTSSHFLVPRLREDIR
AE--PADLVISIFASAAAAVSRL----KSEFP----------------------GMTTAV
FSSDCC--VHR-IWVQDNTDLFLV-TSQ-TAARYVRRFAPQARI-AVVPTPVRTPFYDP-
-----------PTQEEARGNLGI---PLESR-CVLLMSGSWGL-GP-LVEAAEA------
LAA---------AGVWVLAVAGR--NEKLAA--------------RLSA-LAQR---DHR
VI--PFGFTNRIPELMAASNLVVTSSGD-TCSEARVIGRDLLLM---DVVP-GHGRDNLQ
KELDRGHAEVTST-DSLSLTRS--ALACLDRVKP----PSQRVAVSPQAWEQAFGAALAQ
IGLGVH------------------------------------------------------
------------------------------------------------------------
--------------W
>gi|115449287|ref|NP_001048423.1|	   406 residues, 50 /line  Os02g0802700 [Oryza sativa (japonica cultivar-group)]
------------LASPILN--SLL------------------------------------
----------------------------------------------SLSRRRRP------
--------PPQR-----------------------------------------GLVS-LG
GDGGVVVVVVVD-GVAEGEVDPGDGAGDGGGVPP--------------------------
------------------AAEDEAQVQ---E--EPLLRGGA--VAALASFYAKKVEAGLK
KY--KPDIIISVHPLMQHIPLWVLKW---QGLQ--------------------NRVVFVT
VITDLNT-CHP-TWFHADVNRCYC-PSEEVAKRAALDDLQPSQI-RVFGLPIRPSFC-RA
V----------LVKDDLRKELEL---DPELP-AVLLMGGGEGM-GP-VKKTAKA------
LGESLFDKELGKPIGQLIVICGR--NKTLSS--------------SLQA-LEWK----IP
IK--VRGFETQMEKWMGACDCIITKAGPGTIAEALIRGLPIILN---DFIP-GQEVGNVP
YVVDNGAGVFSKS-SR------ETAKLVARWFGP--DSD-ELKRMSEKALKLAQPEAVFD
IVRDIHELS---------------------------------------------------
---------------------------------------REQGVISQISSSLTSSF----
--FIPSPETTPIQLM
>gi|125541507|gb|EAY87902.1|	   508 residues, 50 /line  hypothetical protein OsI_009135 [Oryza sativa (indica cultivar-group)]
--MAASSSSSSSMASPRGR--SIRETVLETVA--AYH----------QQQRMRRKF----
-----------------RKSLSY---------------------AGELSSAGRA------
--------RGEGGASSSASTTSLCGPDEDDEPFWEE------------EEGTVELVQ-LG
ANRAKNVLILMS-DTGGGHRSSAEAIKDAFRIEFG-----DDYRVFVKD-LCKDHAGWPL
--NNMESSYKFMVKH-VQLWKVAFHTT---S--PRWVHCFY--LAALASFYAKKVEAGLK
KY--KPDIIISVHPLMQHIPLWVLKW---QGLQ--------------------NRVVFVT
VITDLNT-CHP-TWFHADVNRCYC-PSEEVAKRAALDDLQPSQI-RVFGLPIRPSFC-RA
V----------LVKDDLRKELEL---DPELP-AVLLMGGGEGM-GP-VKKTAKA------
LGESLFDKELGKPIGQLIVICGR--NKTLSS--------------SLQA-LEWK----IP
IK--VRGFETQMEKWMGACDCIITKAGPGTIAEALIRGLPIILN---DFIP-GQEVGNVP
YVVDNGAGVFSKS-SR------ETAKLVARWFGP--DSD-ELKRMSEKALKLAQPEAVFD
IVRDIHELS---------------------------------------------------
---------------------------------------REQGVISQISSSLTSSF----
--FIPSPETTPIQHM
>gi|30687800|ref|NP_568394.2|	   468 residues, 50 /line  MGD2 (monogalactosyldiacylglycerol synthase 2); 1,2-diacylglycerol 3-beta-galactosyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
-----------MATTV----MALAEKVLERVYGTSKS----------AVSVTSGDGE---
-----------------KTHRHT---------------------HHHIHRIKSY------
--------DD-----------------------IDE------------DESSLELIQ-IG
AERTKNVLILMS-DTGGGHRASAEAIRDAFKIEFG-----DKYRVIVKD-VWKEYTGWPL
--NDMERSYKFMVKH-VQLWKVAFHST---S--PKWIHSCY--LAAIAAYYAKEVEAGLM
EY--KPEIIISVHPLMQHIPLWVLKW---QELQ--------------------KRVLFVT
VITDLNT-CHP-TWFHPGVNRCYC-PSQEVAKRALFDGLDESQV-RVFGLPVRPSFA-RA
V----------LVKDDLRKELEM---DQDLR-AVLLMGGGEGM-GP-VKETAKA------
LEEFLYDKENRKPIGQMVVICGR--NKKLAS--------------ALEA-IDWK----IP
VK--VRGFETQMEKWMGACDCIITKAGPGTIAESLIRSLPIILN---DYIP-GQEKGNVP
YVVENGAGVFTRS-PK------ETARIVGEWFST--KTD-ELEQTSDNARKLAQPEAVFD
IVKDIDELS---------------------------------------------------
---------------------------------------EQRGPLASVSYNLTSSF----
-----------ASLV
>gi|92884240|gb|ABE87260.1|	   456 residues, 50 /line  Monogalactosyldiacylglycerol synthase [Medicago truncatula]
MEVSYVSPESSKVVSPR----TLRKSIVEKVFGKSY------------------------
------------------------------------------------------------
---------------SIKGSGSFKKRSESQSSINED------------NEGGMELME-IG
AERTKNVLILMS-DTGGGHRASAEAIRDAFQIEFG-----DEYKIFVKD-VWKEYTGWPL
--NDMEGQYKFMVKH-VQLWKVAFHST---S--PKWIHSVY--LAAVAAYYAREVEAGLM
EY--KPDIIISVHPMMQHIPLWVLKW---QGLE--------------------KKVIFVT
VITDLST-CHP-TWFHPWVNRCYC-SSEEVAKKALLEGLEESQT-RTYGLPIRPSFA-RA
V----------LVKDELRKELKM---DPDLP-AVLLMGGGEGM-GP-VKKTAKA------
LAESLYDKENEKPIGQIVVICGR--NKNLVA--------------SVEA-IEWK----IP
VK--VRGFETIMAKWMGACDCIISKAGPGTIAEALIRGLPIILN---DYIP-GQ------
-----ATGVFTRS-PK------ETARIVAGWFTT--KQD-ELKTMSENALKLANPEAVFN
IVRDIHELA---------------------------------------------------
---------------------------------------KQREP-GNFPYELTSSF----
-----------TSII
>gi|115475782|ref|NP_001061487.1|	   408 residues, 50 /line  Os08g0299400 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------CG-RK
TAAAKNVLILMS-DTGGGHRASAEALRDAFRLEFG-----DAYQVFVRD-LGKEYGGWPL
--NDMERSYKFMIRH-VRLWKVAFHGT---S--PRWVHGMY--LAALAYFYANEVVAGIM
RY--NPDIIISVHPLMQHIPLWVLKW---QSLH--------------------PKVPFVT
VITDLNT-CHP-TWFHHGVTRCYC-PSAEVAKRALLRGLEPSQI-RVYGLPIRPSFC-RA
V----------LDKDELRKELDM---DPDLP-AVLLMGGGEGM-GP-VEETARA------
LSDELYDRRRRRPVGQIVVICGR--NQVLRS--------------TLQS-SRWN----VP
VK--IRGFEKQMEKWMGACDCIITKAGPGTIAEALIRGLPIILN---DFIP-GQEVGNVP
YVVDNGAGVFSKD-PR------EAARQVARWFTT--HTN-ELRRYSLNALKLAQPEAVFD
IVKDIHKLQ---------------------------------------------------
---------------------------------------QQPATVTRIPYSLTSSF----
-----------SYSI
>gi|147843668|emb|CAN84152.1|	   520 residues, 50 /line  hypothetical protein [Vitis vinifera]
--------MTQEPSS----VLDFESKLGAVALDSRFHLLNS-----DGYASFLSNYLYFD
---RSGGLV-GEKGPKLVASLSW--------SSRGV--SRVRRIFGEFNRAVRFHCEKI-
PIGFASVH----------------VNSGDNNGLRGDGN------G-VLEDEGLVLNV-VE
AEKPKKVLILMS-DTGGGHRASAEAIKAAFNEEFG-----EEYQVFVTD-LWSDHTPWPF
--NQLPRSYNFLVKH-GPLWKMTYYGT---A--PRLVHQSN--FAATTTFIAREVAKGLM
KY--QPDIIISVHPLMQHVPLRILRA---KGLL--------------------KKIVFTT
VVTDLST-CHP-TWFHKLVTRCYC-PTTDVAKRALKAGLQSSQI-KVYGLPVRPSFV-KP
V----------RPKDELRKELGM---DEDLP-AVLLMGGGEGM-GP-IEATARA------
LGNALYNEDLGEPIGQVLVICGR--NKKLAD--------------KLRS-IPWK----IP
VQ--VKGFVTKMEECMGACDCIITKAGPGTIAEAMIRGLPIILN---DYIA-GQEVGNVP
YVVENGCGKFSKS-PK------EIAKIVGEWFGP--KAE-ELAVMSQNALKLARPDAVFK
IVHDLHELV---------------------------------------------------
---------------------------------------RQRSFVTQYSCTT--------
---------------
>gi|15236072|ref|NP_194906.1|	   533 residues, 50 /line  MGD1 (MONOGALACTOSYLDIACYLGLYCEROL SYNTHASE 1, MONOGALACTOSYLDIACYLGLYCEROL SYNTHASE A); 1,2-diacylglycerol 3-beta-galactosyltransferase [Arabidopsis thaliana]
--MQNPSTVTQESAAP---VFDFFPRLRGLTSRNRSPCSNS-----DGYALSSSNALYFN
G---FRTLP-SRRMGKTLASLSF--------NTKSSAGSSLRRFISDFNSFIRFHCDKVV
PESFASVG----GV----------GLSSDENGIRENGT------GGVLGEEGLPLNG-VE
ADRPKKVLILMS-DTGGGHRASAEAIRAAFNQEFG-----DEYQVFITD-LWTDHTPWPF
--NQLPRSYNFLVKH-GTLWKMTYYGT---S--PRIVHQSN--FAATSTFIAREIAQGLM
KY--QPDIIISVHPLMQHVPLRVLRS---KGLL--------------------KKIVFTT
VITDLST-CHP-TWFHKLVTRCYC-PSTEVAKRAQKAGLETSQI-KVYGLPVRPSFV-KP
V----------RPKVELRRELGM---DENLP-AVLLMGGGEGM-GP-IEATARA------
LADALYDKNLGEAVGQVLIICGR--NKKLQS--------------KLSS-LDWK----IP
VQ--VKGFITKMEECMGACDCIITKAGPGTIAEAMIRGLPIILN---GYIA-GQEAGNVP
YVVENGCGKFSKS-PK------EISKIVADWFGP--ASK-ELEIMSQNALRLAKPEAVFK
IVHDMHELV---------------------------------------------------
---------------------------------------RKKNSLPQLSCTA--------
---------------
>gi|1805254|gb|AAC49624.1|	   525 residues, 50 /line  monogalactosyldiacylglycerol synthase [Cucumis sativus]
--MRNPSTVVQENGS----VSDFISQLGYFAFSSRFLNLNS-----EGCSGSSSHSLYLN
G---FENYRCVKRPPRSGASLSL--------SSRGS--SSLRRFVNEFNNVIKFHCHK-P
PLGFASLG----------------GVSDETNGIRDDGF------G-VSQDGALPLNK-IE
AENPKRVLILMS-DTGGGHRASAEAIKAAFNEEFG-----NNYQVFITD-LWTDHTPWPF
--NQLPRSYNFLVKH-GTLWKMTYYVT---A--PKVIHQSN--FAATSTFIAREVAKGLM
KY--RPDIIISVHPLMQHVPIRILRS---KGLL--------------------NKIVFTT
VVTDLST-CHP-TWFHKLVTRCYC-PSTEVAKRALTAGLQPSKL-KVFGLPVRPSFV-KP
I----------RPKIELRKELGM---DENLP-AVLLMGGGEGM-GP-IEATAKA------
LSKALYDENHGEPIGQVLVICGH--NKKLAG--------------RLRS-IDWK----VP
VQ--VKGFVTKMEECMGACDCIITKAGPGTIAEAMIRGLPIILN---DYIA-GQEAGNVP
YVVENGCGKFSKS-PK------EIANIVAKWFGP--KAD-ELLIMSQNALRLARPDAVFK
IVHDLHELV---------------------------------------------------
---------------------------------------KQRSFVPQYSG----------
---------------
>gi|50725897|dbj|BAD33425.1|	   535 residues, 50 /line  putative MGDG synthase type A [Oryza sativa (japonica cultivar-group)]
--MPA--PTASSLAAA-----------ADPALPAAFLSLPS-----PLLPASPPLPAAPA
P---SSNAFCVPRGPARAVAVSVSVSAYGAGSTAAA--SRLHRMWAEFSRFVRLHGNQIA
PLGFASLG----------------LGVGGGGGGSGEGAGGGGGGGGGEVDGLVEEEGVAR
AEAPKKVLILMS-DTGGGHRASAEAIKAAFIQEFG-----DDYQVFVTD-LWTDHTPWPF
--NQLPRSYSFLVKH-GPLWKMTYYGT---A--PRVVHQPH--FAATSTFIAREVAKGLM
KY--QPDVIISVHPLMQHVPLRILRS---KGLL--------------------DKIPFTT
VVTDLST-CHP-TWFHKLVTRCYC-PSAEVSKRALKAGLQPSQI-KVYGLPVRPSFV-KP
I----------RPEDELRRELGM---DEYLP-AVLLMGGGEGM-GP-IEATARA------
LGDALYDEVLGEPTGQILVICGR--NKKLTS--------------RLQS-INWK----VP
VQ--VKGFVTKMEECMGACDCIITKAGPGTIAEAMIRGLPIILN---GYIA-GQEAGNVP
YVVDNGCGKFSKS-PE------QIAKIVADWFGP--RSD-ELKMMSQNALKLARPDAVFK
IVHDLHELV---------------------------------------------------
---------------------------------------RQKCFVPQYACAS--------
---------------
>gi|5912588|emb|CAB56218.1|	   522 residues, 50 /line  MGDG synthase A [Spinacia oleracea]
--MSHPSTVTSEPSN----LLDFVPKLGNFVLNSSLHGNNS-----NGYSSFSSNSVHFG
G------LA-TQNRYKFVNSLSF--------SKEG---SNLKRILSDFNRVIRLHCDRI-
PLGFSSIG----------------LNSGESNGVSDNGH------G-VLEDVRVPVNA-VE
PESPKRVLILMS-DTGGGHRASAEAIKAAFNEEFG-----DDYQVFVTD-LWSEHTPWPF
--NQLPRSYNFLVKH-GPLWKMMYYGT---S--PRVIHQSN--FAATSVFIAREVARGLM
KY--QPDIIISVHPLMQHVPLRILRG---RGLL--------------------EKIVFTT
VVTDLST-CHP-TWFHKLVTRCYC-PSNEVAKRATKAGLQPSQI-KVYGLPVRPSFV-RS
V----------RPKNELRKELGM---DEHLP-AVLLMGGGEGM-GP-IEATARA------
LGNALYDANLGEPTGQLLVICGR--NKKLAG--------------KLSS-IDWK----IP
VQ--VKGFVTKIEECMGACDCIITKAGPGTIAEAMIRGLPIILN---DYIA-GQEAGNVP
YVIENGIGKYLKS-PK------EIAKTVSQWFGP--KAN-ELQIMSQNALKHARPDAVFK
IVHDLDELV---------------------------------------------------
---------------------------------------RQKIFVRQYSCAA--------
---------------
>gi|9884651|dbj|BAB11979.1|	   530 residues, 50 /line  MGDG synthase type A [Glycine max]
----MNNGVSQESSV----LLDLASHVNRFAFDS----FRS-----DNNKTLLSNFLHFN
G-----NTRTGAAAAKRGVSLGG--------KVGGA-SVRFGNILNDFNRAVRFHCEKI-
PIGFASLRVGDGGDGADG------NGNGEGNGVRVDEC------G-GVENEGFRGNG-VE
GEKPKKVLILMS-DTGGGHRASAEAIKAAFYQEFG-----DDYQVFVTD-LWADHTPWPF
--NQLPRSYSFLVKH-GPLWKMTYYGT---A--PRVVHQSN--FAATGTFIAREVAKGLM
KY--QPDIIISVHPLMQHVPLRILRS---KGLL--------------------KKIVFTT
VITDLST-CHP-TWFHKLVTRCYC-PTTDVAQRALKAGLQQSQI-KIFGLPVRPSFV-KP
V----------QPKDELRRELGM---DEDLP-AVLLMGGGEGM-GP-IEATARA------
LGDSLYDENIGAPVGQILVICGR--NKKLAN--------------KLSS-INWK----VP
VQ--VKGFVTKMEECMGACDCIITKAGPGTIAEAQIRGLPIILN---DYIA-GQEAGNVP
YVVENGCGKFSKS-PK------DIAKIVAEWFGP--KAY-ELQQMSQNALRLARPDAVFK
IVHDLHELV---------------------------------------------------
---------------------------------------RQRSYLPEYSCTA--------
---------------
>gi|9884653|dbj|BAB11980.1|	   535 residues, 50 /line  MGDG synthase type A [Nicotiana tabacum]
-MMQHSSSVTQEPTN----PFGFVSQVGSFVFNNSCSRVSKSNFTLDSYSNLLSNYLYFD
CNVKKDSLN-HKNKPKASPLLSLSI------SNKSA--SSFSRVLFQFNKAIRFHCEKI-
PLGFASVG----------------VNCGESNGVREEGS--------VVENEGIPDNG-VE
SEPPKKVLILMS-DTGGGHRASAEAIRSAFNEEFG-----DKYQVFITD-LWTEHTPWPF
--NQLPRSYNFLVKH-GSLWRMTYYAT---A--PRLVHQTN--FAATSTFIAREVAKGLM
KY--QPDIIISVHPLMQHVPLRILRS---KGLL--------------------KKIIFTT
VITDLST-CHP-TWFHKLVTRCYC-PSEEVAKRALRAGLKPYQL-KVYGLPVRPSFV-KP
V----------PPKVELRKELGM---EEHLP-AVLLMGGGEGM-GP-IEATARA------
LGDALYDEIHGEPIGQVLVICGR--NKKLFN--------------RLTS-VQWK----IP
VQ--VKGFVTKMEECMGACDCIITKAGPGTIAEAVIRGLPIILN---DYIA-GQEAGNVP
YVIENGCGKFSKS-PK------KIANIVAQWFGP--RQD-ELRIMSQNALRLARPDAVFK
IVHDMHELV---------------------------------------------------
---------------------------------------RQRNFEPQ-CCPA--------
---------------
>gi|116621886|ref|YP_824042.1|	   400 residues, 50 /line  hypothetical protein Acid_2769 [Solibacter usitatus Ellin6076]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-MTRTKVTLIYI-DSGGGHRAAATALCEVIRQQQ------RPWDVRMVC-IQDLLDPID-
FIRKSTGVRFQDVYNIMLRRGWTRGTAQLI-----PMMHRV--IRASHDSQVKVLREYWR
GH--RPDLVVSLIPHYNRALKEAL----EGAWP---------------------GTPYVT
LLTDIAD-YPPHFWIERINQWVIC-GSRKAAAQAREIGIPAPRILQASGMILSPRFYEPL
T----------VDRAAERVRLGL---RPEMP-VGLVLFGGEGS-RE-MVRIARA------
LNYS-------GSGVQLILVCGK--NDAAAA--------------ELRA-LEAA----TP
ML--VVGFTREIPRLMEISDFFIGKPGPGSLSEALAKKLPVIVQR-NAWTM-AHELYNTE
WIEELGAGVVIESFSK------QLDGAVRQLLEP-----RRYAQYR-GCAAATRNVAAYE
IPEMLGSILS--------------------------------------------------
----------------------------------------ESRPDQACDFGAQSLPG---
----------SVRSA
>gi|118063998|ref|ZP_01532330.1|	   431 residues, 50 /line  Monogalactosyldiacylglycerol synthase [Roseiflexus castenholzii DSM 13941]
----MSDAH---------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------SE-PS
TSGAPRILFAIS-DTGGGHRSGAQAIAAAIEQRVG-----DAVETYIID-IFTHTGVPVV
--RNAPVVYDKLSTRWLPLYDTLYRLTD-----GRRRIDAL--TKVVYFAAHRNILRVLE
AV--QPTLVVSVHPLLNRLIGNAR----RTYRL---------------------SFRFIT
VVTDLVS-LHA-SWADPDAELCIV-PTNEAYERMLRLGMPESKL-VRTGFPVHPKFVAYH
-----------QTRDAAQANLGL---APELF-TVLVTSGGVGS-GN-MEQLVRN------
IHTA-------YPQLQVLVVTGR--NTALRE--------------RLEQ-IGFG----PN
VR--IFGFVTNMEELMAASDIVISKAGPGTLMEALVMRRPVIVT---QAVG-MQERGNID
FVLNHELGLFCPT-ID------RIVPVLAELMEP-----STYAAVTARLVDAVPRDGAAQ
IAAILLDQLHLAPPVRR-------------------------------------------
-----------RRRLRLPSVRLPRPRAIARRLH-----------------------LPRL
RRLVRWRRSSSHRRV
>gi|118592309|ref|ZP_01549701.1|	   405 residues, 50 /line  hypothetical protein SIAM614_25816 [Stappia aggregata IAM 12614]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
MTDPVHVAVIYT-DAGGGHRASAFALKACLE--GS-----GRYRVSLIN-PYTTLIPHLD
LFSRFGSRTGENIYNEVILRQGRTGLTCWLFYA---ALRLN--YVFCERPAISILARHFE
DI--RPDVVLSVMPLGNRVMLEALK----RYRA-------TITDGL--------LPEGAV
MITDWAELARG-VWFPNRADYHAICGTQDALRNAEKLPKLAGKVHAMGGLLIRPEFTNPA
-------------ERASKQALNL---DPARP-VVTVLYGAQGS-MR-MLELAKA------
MRDV-------PHTAQVVFLCGR--NEALAG--------------ELRT-MDLP----YP
VQ--VLGFTDKVAQYLSASDLFIGKPGPGSTSEAMALGLSMLLD---TSLALPQEAAVLR
HVVKTGAGQAFST-SA------DFSQHFKAAI----TAIESGQARQPLA----ANTSPAD
ILEIMDRIGASRV-----------------------------------------------
---------------------------------PAAGSLQPTGELPRT------------
---------RHVSRA
>gi|118726376|ref|ZP_01575003.1|	   396 residues, 50 /line  Monogalactosyldiacylglycerol synthase [Clostridium cellulolyticum H10]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MKNVIIISSDYTGHGHKSISEALQEQFCIH-------EDVCLNIID-GFELGGNMWI
---KVGKSYGMVTRNAKEIWKLAWKISK-----RNQT----FIHEFTELTIRENFIKLLR
KL--KPDLILSVHPVFNTPIINIL----KEYKV---------------------NIPFAT
FVADLVS-ISP-MWADSRADCIIC-PTEEAKQRCIGFGVPEHKL-EVIGFPVRSRFTQHV
S------------QNMSHNDYTL---DRPLE--CLIMSGGEGS-GD-MNNVAKI------
LLD--------NFNCNIRIIAGR--NESLKD--------------KLEKTISQQ--YPGR
VE--VYGYVTNIQDYMLKSDIAFTRGSPNVMMEAVACNVPLIIT---GALP-GQEQENPD
FAVNNNLGIYCDD-LS------SLAAVVSGLLA---DNAKRLNEIKQAQREYFDHAAAGK
IVDHVLSLIKNEVFIYPSE-----------------------------------------
-------------------------------LRRKKKFLT--------------------
------LKLQSRKSS
>gi|119880112|ref|ZP_01646471.1|	   397 residues, 50 /line  conserved hypothetical protein [Salinispora arenicola CNS205]
------------------------------------------------------------
----------------------------------------------------MKPRHSGR
RPRAGAV--------------MPDGIRPVPLGAA---------VGAG-----RDDPG--G
DPGRMRILVVSA-DIGAGHDAAAAELAARLGGD--------EVVVEQLN-FFTALPRPLH
--LLVREGYRTMLQRFPWSYDALFRFTD-----RSSLTLRAFR-----AALRAAAPRMLS
RIPADTRLVVTTHPFANQLLGPM----RGAGQL---------------------TVPVLS
YVTDFV--IHP-VWISPGVDTYCV-IHEATQQQAMARGARDVRV---VDPLISAEFASLS
T----------ACRRTARARFGL---PAQDR-LALIVAGSWGV-GD-VTRTARD------
VLAT--------GCVTPVVACGR--NDDLRH--------------RLRT-F--------P
GH--IMGWVDDMPTLMRAVDVVVENAGGLTCQQSLACGLPTVTY---RPIS-GHGRANAR
VLADAGLTTYVTT-AA------QLQPVLSALTL----AEGGLTT---------PAVTATD
MAALISDVVRT-------------------------------------------------
-----------------------------------------DHR----------------
---------------
>gi|145593206|ref|YP_001157503.1|	   397 residues, 50 /line  UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase-like protein [Salinispora tropica CNB-440]
------------------------------------------------------------
----------------------------------------------------MKPWPGGR
SPRAGT--------------------SPAAAGTS---------PAAG-----RDDPD--G
GPGQLRILVVSA-DIGAGHDAAAAELAARLAGD--------GV-VEQLN-FFAALPRPLH
--RLVREGYRTMLQRFPWSYDALFRFTD-----RSSLMVRAFR-----AALRAAVPRMLS
RISADTCLVVTTHPFANQLLGPM----RGTGQL---------------------TVPVLS
YVTDFV--VHP-IWISPGVDTYCV-VHDGTQRQAAARGAADVRV---VNPLISAEFAASA
T----------ACQRTARARFGL---PEQER-LALIVAGSWGV-GD-VARTARD------
VLAA--------GCVTPVVACGR--NVRLRQ--------------RLRT-F--------P
GH--VLGWVEDMPTLMRAVDVVVENAGGLTCQQSLAGGLPTVTY---RPIS-GHGRANAQ
LLAEAGLTTHVTS-AA------ELGPALTKLTG----VAGSPAL---------PVGSATD
MASVVSEVVRS-------------------------------------------------
-----------------------------------------GNRLDRKRP----------
--------------V
>gi|119963205|ref|YP_947649.1|	   487 residues, 50 /line  polysaccharide biosynthesis protein [Arthrobacter aurescens TC1]
------------------------------------------------------------
-------MR-TTSA----------------------------------------------
-------------------------------------------------------RT-KA
TANGQRVLILSA-GVGSGHNSAATAVQQACAAR-D-----DIAEVQVLD-VLKVSSVLYR
--ALLSKGYFVLVEDLPWLVEWGYDISN-----PPFRRRGP--IDPWTRLNASPVISAIK
QF--RPTAIVCTHFLPAQLMASL----LLRGVI---------------------DAKTAV
VTTDYD--FQG-LSLSGAFHKIFV-AREEGKVELMALGLPPDRV-VATGIPITKQPSPAP
------------VRD------------AKKPPMLIISAGATGG-DY-AVSVVRQ------
TMHM-------RSAFTATVVCGN--NIALRQ--------------RIEK-LVAT--ARDR
YS--VLGFTTEMPQLLQRADLFVGKPGGLSASECMAAGLPMVLV---NPIP-GQEVRNGD
YLMEQGAAVRCNA-AA------TIGWKIDQVL----REPGRLQKMQAAAQRTGRPDAAAD
VLGALLGGPSRPLVVTRAAQRTIL--------------AASEQRFVATDLTGPSSLVRLV
DQASGSTVALLQEEELADLQKRYTTPDEDMVLRPGRASLILHWEERRLLRAMLRGDDHLA
VRVEGPLAPFRDLPG
>gi|62422866|ref|ZP_00378044.1|	   470 residues, 50 /line  COG0707: UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Brevibacterium linens BL2]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MILSA-GVGTGHNSAAAAVQQACSAR-A-----DVAEVQVLD-VLQVSSALYR
--DVLGKGYFVLVEGMPWLVEWGYDASD-----PPFRRRGP--IDPWTRINALPVIRAIK
RF--RPTAIVCTHFLPAQLLATL----ILRGVV---------------------DAKTAV
VTTDYD--FQG-LWLTNAFHKFFV-AREEGRVELTAFGLPPDRV-AATGIPIAAESNTAP
------------ERD------------ASAPPMLLISAGAKGG-GY-AEAVVRQ------
TLHM-------RSAFTATVVCGH--DEELRR--------------RIEQ-LVAP--AGNC
YR--VLGFTTEMPQLLRRADLFVGKPGGLTASECMAAGLPMVLV---NPIP-GQEVRNGD
YLMEQGAAVRCNS-AA------TIGWKIDEVL----REPGRLQRMQVAAQRTGSPDAAAD
VLSGLLDGPSRPLVVTRAAQKTIL--------------AESERRVVATDLTGPSSLVRLV
EEVAGNTVALLQAEELIALRKRYATGAGGLILRRDHALVSLRWEQRRLLRAMLRGEDVLP
VRVEGPSTPFRTLPD
>gi|125975655|ref|YP_001039565.1|	   421 residues, 50 /line  hypothetical protein Cthe_3177 [Clostridium thermocellum ATCC 27405]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--MIKNILILSSNNTGHGHKSITESLLEQFSHY-------PDVNVHVID-GFTLAGNFGL
---RIGKLYGSVTRNAKELWKLVWELSL-----KKPS----LLNDFTEVAIKDNFLKLIC
NI--KPDLILSVHPNFNGSVLNIL----EDYNI---------------------KVPFVT
LLADIVS-ITP-LWADPRADYIIC-PSKESKFKCLEFGVSESKL-IETGFPVRQKFLKHL
EKN------------GENNTQNIKKYTGDRPLECLIMSGGEGS-GN-MSRIASI------
LLK--------NFNCRVKIVTGR--NRLLKR--------------RLER-TIGE-RFGDR
VE--IYGFTENIQDLMLSSDIAFTRGSPNVMMEAVACNVPLIIT---GNLP-GQEEGNPA
YMQKYNLGVVCKD-VR------KLRHTVNELLE---NNGEKLNRIKQSQKEFLNPNVAKE
IVSFLLSIDKQEE-----------------------PCFPEDLF-------------SGD
FPRFWELHKR----------ISMSHNKKIILK----------------------------
-----RHKKIGTKQK
>gi|126697585|ref|YP_001086482.1|	   401 residues, 50 /line  putative glycosyl transferase [Clostridium difficile 630]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--MSKKVLIMSA-STGGGHNRAALAIKEELTSKTL---DGEPIECEIID-SLKLVNNTMD
--KIISRGYEKSAIYTPKAYGSVYRLSE-----TNLLSKNEFKDNLLITFMAKKFKKLIR
SE--KPDLIIGTHPFPMIALSTL----KKNFNLHNNESNAYTEHFYKHYTNTINVPPLIS
VLTDYT--THS-TWIQNEIDYYIV-GHEYVKELLVFDGVEPSKI-RTFGIPVEKSFLSHR
------------DKDIVLSELNL---SPDKL-TVLLMGGSFGA-GN-IKETLDE------
LLDT-------DRDFQILVITGK--NESLKE--------------KIEK-KLMSRYHDKN
VC--VLGYTDKMNDILASIDVLVSKPGGLTTTEALLKDVPMIVP---YYIP-GQEEENLD
FLSNCGAALRTTK-KY------NLSILLKV----LIDDPSRLEMLKRNIKSIRKSNSAQN
IANLILNIISG-------------------------------------------------
------------------------------------------------------------
---------------
>gi|134299813|ref|YP_001113309.1|	   387 residues, 50 /line  Monogalactosyldiacylglycerol synthase [Desulfotomaculum reducens MI-1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--MLNKILVLSV-SAGEGHMRAAAAVKEEIIRR-N-----SKAEVIILD-TFRYASPLIE
--KVVLGTYMEIIKMSPIIYGYLYRQAEKEKPFSGFAKNEF--NRIMNRLAAPKLVTFID
QM--QPQAIMCTHPFPLGILTHL----KSVGKC---------------------KVPIIA
AITDFT--VHP-FWLFNDVDYYLV-AVDPLVKSFAEHGIQYNKI-KATGIPIDPKFAIPK
------------NKSVLRYRWNL---EPDLP-AVLIMGGGLGM-GP-LGDIVKE------
LASS-------GLPCQMVVVCGR--NEQLRN--------------KLIK-LQPT--LSRK
VE--VLGYINNIEDLMATCDLMIGKAGGLTSAEAMATGLPMFIT---DPIP-GQEERNAE
FLESMGAARLVRG-QK------DLVHRVKEFL----SNVAIQKSMADAAKQIGRPRSAEA
AVTVMEELC---------------------------------------------------
---------------------------------------ATYKTKHMVS-----------
--------------E
>gi|139439637|ref|ZP_01773050.1|	   452 residues, 50 /line  Hypothetical protein COLAER_02077 [Collinsella aerofaciens ATCC 25986]
----MTL-----------------------------------------------MHY---
---NDKSRN-KA----------------------------------------------EG
ELSMDQT----------------QTGNSAPLPMQ---------ATPQPEQM-----T-VL
PAQKPLVTIVHA-SVGSGHKAAANAIAQAFDLIRGTKGIPEDIEIEVLD-ILDFGRIKF-
--DGNKTAASFTGAT-RPIYDLTWRYT---L--TGHLLWGG--GTAWSRIMFPAFNEYIR
RR--RPIAVVATHITAANVAVGAR----VITGI---------------------DYPVIC
VPTDYE--VEG-FWPHKDTDLFCV-ANEFMAETLRPRKVPESKI-RITGIPIRAGFDTDY
K------------REDELSKFNL---PIDKT-VVLVMAGASLP-QP-YVRFRAAMDHTLP
FLR-S------FEDMHFVFLPGK--DKEYAA--------------RLKT-LFDA-MKLDN
VT--VLDYVDDMAALMHGCDLAILKSGGLTVTECLCAHLPMILL---GKSY-GQEKANTT
MLTGMGASMHVTT-AR------ELIVTLRH----LHDHPESLKALLINGEVLRRPRAAED
IAIATMELVG--------------------------------------------------
----------------------------------------KPQKRKRAFCRF--------
-----YWGGKPAHIR
>gi|145343579|ref|XP_001416396.1|	   501 residues, 50 /line  Monogalactosyldiacylglycerol (MGDG) synthase [Ostreococcus lucimarinus CCE9901]
----MLGADTTQSAS----LLAATERV----------NLGS-----KSMTMLRDASY---
---GFECRR-TVRSPKRSTGVKCSVQ-----------DLSIDVEINDMNISAVLKAQSGR
PLNSGEC--------------VISNAQQMKTCSN------------VDVGGRSPSDF-IG
HRSGRRVMCLMS-DTGGGHRASAQALKDCFELIYG-----DEFSVHIVD-LWSSNSPWPF
--SKMPNSYFFLVKN-PWLWRLNFRCS---E--PRLLHEIM--FKGYTVIVSKHFARAFK
EI--DPHLIVSVHPLMQHVPMRVLQQMHKQSLI--------------------SRVPFAT
VVTDLTR-CHA-TWFHRSVDRCFV-ATNLVAAQAMRLGLKSEQI-ACHGLPIRPSFSARR
Q----------LSKHELRTKLAL---DTDAP-TVMLVGGGEGM-GK-LQETAEA------
LAQTL------RSTHQVIVVCGR--NLRLSD--------------FLQS-KVWP----LK
MV--VKGFVHNMAEYMSACDCVISKAGPGTIAEAMICGVPIVLN---GCIP-CQEEGNIP
FVTDNKVGAYSEN-PR------TIAQIVAEWLAP--ENNAELLAMSSRARALGRPEATFD
IIRDLAALV---------------------------------------------------
---------------------------------------TETQEC---------------
--------------D
>gi|148378133|ref|YP_001252674.1|	   413 residues, 50 /line  cell wall synthesis protein [Clostridium botulinum A str. ATCC 3502]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MKILILSV-SAGGGHIHAAEALKSYIKLN-N-----NKAEITVID-TLKYINPLID
--KVIIGSYLKTLKVTPSLFGKLYDHSED----DEGLATVI--SSNLSKIMTYKLSHLVN
EL--NPDIIICTHPFPAEMISIM----KDKGKL---------------------NIPSLT
ILTDYAP--HS-FWIQEHTDAYVV-SNSDMIDEMVARNVPKNKI-FDFGIPVNPSFLKKY
------------DKEKTLKELDL---NINIP-TFLIMGGSLGI-GK-ISDLYSE------
LIKI-------DQNMQIIIITGN--NKKLYS--------------ELNK-LKEN--SNKE
TR--IIGFTDKVNKYMQCCDLLLTKPGGLTITEALVSNIPMAVF---SPIP-GQEEKNAK
FLLRHNLAISIDS-IE------DTKDIISDLL----KSESSLKTMSLNCNKFAKPNCGND
IYNLLEFLISIK-------------------------KNDSSKNKMY-----------VS
NPVISHKSKNL----FKSIE-------KYFIK----------------------------
--------TAEKFLL
>gi|148656649|ref|YP_001276854.1|	   482 residues, 50 /line  Monogalactosyldiacylglycerol synthase [Roseiflexus sp. RS-1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--MKHRVLILST-SAGSGHKSAAAALEKVFQRSP------QVEELVNLDA-LERTNELYR
--AFYSDLYLRLVQERPQLVGWWYQASD-----EPWKTDTF--RLLFDRINADPLTRFIR
EF--RPTITVCTHFMPAGIVAQLL----AEDAI---------------------DTRLAI
VTTDYD--FHS-MWLSPRFNRYFV-ALEETKVHLMALGLPEDRI-TISGIPVDPAFEAPI
N------------RDEVLAHYHL---RPDLP-MILVSAGAAGI-GP-ARDVVQQ------
IMTM-------KTPSQVIVVCGR--NEELRK--------------ELIE-LTEP--QAKR
--FRLLGFTDDMPSLMKIATILIGKPGGLTSSEAMAAGLPMVII---SPIP-GQEERNSD
HLLEEGVALRCNQ-MT------TLAYKVDRLL----QNPERLARMRENTRNIGRPDAARV
IVDTLLHEVNEPVVIEESPPIRILPFRINLADLFDPPLADDDRFTIVDALSG-----ELI
DEVTGKEMRVL----FDNLEIESTTDADFYINRDTLALLADRGASPHLIDVLQRALGNRD
ECDIR------WRRQ
>gi|148658221|ref|YP_001278426.1|	   396 residues, 50 /line  Monogalactosyldiacylglycerol synthase [Roseiflexus sp. RS-1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-MRNVRILILTT-DAGSGHRSAAQAIEAALLHNYS-----QSVQVTIANPLHEPSSPSLL
--RHAETFYLSTIQHAPERYDRAHALTDAA-----AYAVLL--RSAMGLAIGDALRRLLV
RH--APDVVISVYPLFTALVADAY----RGVRG---------------------RPGLIT
VVTDLGH-VHH-TWFSPVDDLCIV-PNAQVRTRALGCGLEPHQV-RIVGIPVHPRFAAPR
-----------AAPEDVRRDLGW---RTDLV-TVLISGGGAGV-GP-LAELSIA------
ADEA-------NEHIQLAIVTGH--NRELAA--------------TLRA-RTWK----NP
TH--IYGFVP-MADMMYAADIVATKAGGLSISEALAVGRPLLIY---GAAP-GQEAGNLE
YVVRRGAAQYTPD-AT------QFVAGIQRWI----ERPEARRAAADAARAAGNPLAAFE
IARIVRDLAL--------------------------------------------------
----------------------------------------SRDAAPRLAPR-VSLSEWLS
------------SWR
>gi|149094341|ref|ZP_01840232.1|	   402 residues, 50 /line  murG2 [Clostridium kluyveri DSM 555]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MKVLILSI-SAGGGHGTAAEALKDHIVLR-A-----PQSEIQIID-TLKYINPIID
--KVVIGGYLKSLKVYPYLYGKLYTYSEYD----YKITNVI--SSRLIEAMTCKLLPLIN
DF--NPDILISTHSFSAEMLSVL----KSKYNM---------------------TIPCMC
IITDYYP--HN-SWLHPYLDAYVV-SNKDMIDKMISKGISENTI-YNLGIPVKPEFSINY
------------CREDILKSLRL---SPSKF-TILIMGGSLGM-GK-ILNIYKQ------
LDKV-------NADIQIIIITGK--NKKLYS--------------ELLK-IGES--SLKN
TI--IIGFTQHVNKYMQASDLLLTKPGGLTITEALICKIPIGLL---SPIP-GQEEKNAE
FLLKHNLAIDLTD-IE------KFKENIEKLL----NSRDILNIMTENCYKFSKPYASDD
IFNLINRLVQ--------------------------------------------------
----------------------------------------KKLIEPYFSKPKKSMLKVTL
EHF----LNAQKNIF
>gi|150270637|gb|EDM97946.1|	   387 residues, 50 /line  hypothetical protein BACCAP_04426 [Bacteroides capillosus ATCC 29799]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----MNILFTC-GGTAGHINPAVALARLFQERN------PGCRILFVG-ADGGMETR--
--LVPKEGYDIRTVTIT---NFQRSLT---P--AAVGHNLK--TLFNMGRSRKQADAILD
DF--KPDLVVGTGGYASYPVVNAA------AKR---------------------KIPTAV
HESNAVP-GLTTKALSKVVDVVMV-GFEES----RSHYDNPEKV-VVTGTPVRGDFFQ--
-----------YTKKEAREKLGI---NDDRP-LLLSFFGSLGA-AV-MNDHMTAILS--R
EVRI-------GAPFYHIHGAGRDY-AGMRARLEQEGLRVDGDSVKLAN-----DPKDTG
VE--LREYIYDMPLIMAAADLVVCRAGASTISELTAIAKPAVLVPSPNVVA-DHQTKNAR
VLSDRGAALLVSE-QECDGKTDAFFNTIADLL----NHPEKRENMAKALREMAIPDASEH
IYQTLVGLLK--------------------------------------------------
----------------------------------------GK------------------
---------------
>gi|15806096|ref|NP_294800.1|	   411 residues, 50 /line  cell wall synthesis protein, putative [Deinococcus radiodurans R1]
------------------------------------------------------------
-------------------------------------------------MARQHRLRAGR
PVAAEAC-----------------------------------------------MSG-GE
TGRTLRALFMSV-SLGAGHDQAQQAVKQAFAER-G-----VELLGAEHD-SVEYLSTFER
--SFTVDLYEFELRYAPWLYRGFYWLTDQD-----QPWNII--SRMFTWLGMGAFKDELR
EL--RPEVVINSFWAPAAVCDTL----RAQTGQ---------------------RFLNCL
IVTDYR--AHL-HWARRETDLLMV-ASEETRRQMLERGVRPEQV-EVTGIPISPAFREVL
AAD------RWALRAELFSEMSL---RPGVP-LLLLSGGGRGHYA-AAADVLTE------
LGNL-------GRAVQVLVPASR--QGEGTE--------------TIGG---------AT
VH--HLGFRRDLPRLLAASDLVVGKAGGLTVAEATALGVPLVIY---APIP-GQEEHNAD
FLERHGAGLWARA-RH------DVRPLVLRAL-----DPAEHARLSAGARAVGIPDAADR
VAGAILRRLG--------------------------------------------------
----------------------------------------DGLG----------------
-----DELGDSRGPA
>gi|27467635|ref|NP_764272.1|	   391 residues, 50 /line  cell wall synthesis protein [Staphylococcus epidermidis ATCC 12228]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------M
VTQNKKILIITG-SFGNGHMQVTQSIVNQLNEMNL-----NHLSVIQHD-LFMEAHPIMT
--SICKKWYINSFKYFRNTYKRFY-YS---R--PNELDKCF-----YKYYGLNKLINLLI
KE--KPDLILLTFPT--PVMSVL----TEQFNI---------------------NIPIAT
VMTDYR--MHK-NWITPYSQRYYV-ATKDTKDDFIEAGVPASYI-KVTGIPIADKFEESI
------------DKEEWLSQQHL---DPSKP-TILMSAGAFGV-SKGFDYMINN------
ILE-K------SPNSQVVMICGR--SKELKR--------------SLKA-KFKD---NPS
VK--ILGYTNHMNEWMASSQLMITKPGGITISEGLSRCIPMIFL---NPAP-GQELENAY
YFESKGFGKIADT-PN------EAIDIVSDL----TNNEETLKVMSSKMLESKVGYSTRK
ICKDLLDLIG--------------------------------------------------
----------------------------------------HSSQPDEIYGK-VPLYARFF
-------------VK
>gi|73663077|ref|YP_301858.1|	   391 residues, 50 /line  putative UDP-N-acetylglucosamine transferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------M
VTQNKKILIITG-SFGNGHLQVTQSVVNQFKEMNL-----DNLTVIEHD-LFLEAHPILT
--SICKKWYINSFKYFRNMYKAFY-YS---Q--PDQLDKCF-----YKYYGLNKLMNLLL
KE--KPDLILLTFPT--PVMSVL----TEQFDM---------------------NIPIAT
VMTDYR--MQK-NWITPFSQRYYL-ATEELKDEFASIGIPKDKL-KVTGIPISDKFETDI
------------DKTAWLSQNHL---DPDKP-TILMSAGAFGV-SKGFGQMIQE------
ILN-R------SPHAQVVMICGK--NKDLKR--------------SLTS-QFKD---FNN
VL--ILGYTKHMNEWMASSQLMITKPGGITISEALTRQIPMIFL---DPAP-GQELENAV
YFEEKGYGRIANT-PE------AAIEQVAAL----TNAPTKLASMSESMDASRIPYSTYK
LCKDLLNLLN--------------------------------------------------
----------------------------------------HSSHYEEVYGK-VPLYAKLF
-------------VK
>gi|28210051|ref|NP_780995.1|	   389 residues, 50 /line  1,2-diacylglycerol 3-glucosyltransferase [Clostridium tetani E88]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MKVLIFSI-SAGGGHSKAAESLKEYIDLY-S-----SKSTVKVID-TLKYINPIID
--KVIIGSYLKTIKITPSLFGKLYDYTE-----SDYGLSII--SAKFNEIMTYRLLPLIK
DF--NPDILIATHPFPTEMLSIL----KSKHKI---------------------NRPIIS
ILTDYAP--HS-FWLHPCIDAYIV-SNKYMISEMVSKGIPKNTI-YPFGIPVSRDFLTNY
------------SREETLSEINF---YSDKP-TILVMGGSLGI-GK-ITKVYEN------
LLKI-------NEDIQIIVIAGN--NKKLYY--------------ELLS-YRHSLDKDST
SY--IIGFTDKVNKYMQASDLLLTKPGGLTITEALVSSIPLALF---SPIP-GQEEKNAE
FLLTNNLAVDLGD-GS------NTKDIIENLL----KDKSKLSNIKENQRKFSKPDVGKN
IYNLILKLIS--------------------------------------------------
----------------------------------------DYKINIEEIYL---------
---------NEKNPD
>gi|42779645|ref|NP_976892.1|	   388 residues, 50 /line  hypothetical protein BCE_0565 [Bacillus cereus ATCC 10987]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
MIKNPKVLILTA-HYGNGHVQVAKTLEQTFRQKG------IK-DVIVCD-LFGESHPVIT
--DITKYLYLKSYTIGKELYRLFYYGVEKI------YDKKI--ASWYANFGRKRLKLLLQ
AE--KPDIVINTFPIIA--VPELK----KQTGI---------------------SIPVYN
VLTDFC--VHK-IWIHREVDRYFV-ATDHVKKVMVDIGVPAEQI-VETGIPIRSSFELKI
N------------SDIIYNKYQL---CKNKK-ILLIVAGAHGVLGS-VKELCQS------
FM--S------VPDLQVVVVCGK--NEALKQ--------------DLLG-LQEK--NPDA
LK--VFGYVENIDELFRVTSCMITKPGGITLSEAAALQVPVILY---KPVP-GQENENAM
YFERKGAAVVIRD-DS------EVFAKTEALL----QDDMKLLQMKEAMKSIYRPEPADH
IVDTILAENH--------------------------------------------------
----------------------------------------VEP-----------------
NHIPIKSPALAQSFT
>gi|51891890|ref|YP_074581.1|	   399 residues, 50 /line  putative UDP-glucuronosyltransferase [Symbiobacterium thermophilum IAM 14863]
------------------------------------------------------------
------------------------------------------------------MERII-
KVCPDLW-----------------------------------------------LPG--G
GAVPTRILLLSA-DFGSGHLAAATAIAAACRSLS------ADCEAVVVQ-----CRSPLL
--GLVGRAYLWQIRHTPDLYRQLYRLPP-----GRPLRR------LVIRVLSGPVRRALQ
QY--NPDVVVGTHPFPAGAALHLL---NRSWPK---------------------RVPVVM
ALTDFAP--HG-FWIWPGVARYFT-ASEQAARELVRRGADAAAV-RATGIPVRMALAADG
TG---------ADRTAGPTAGSS---SSGVR-RVLVIGGGLGL-GP-IAAAVDA------
LLSLP------RPDLRVTVICGR--NEALLD--------------QIRR-RHGS---DAR
LT--ALGFTDQVLDHMREADLLVTKPGGITCAEALALGLPMLLL---DPLP-GPEEENAA
YLAGSGAARVVGV--K------RLAGAADDL---LFRRPERLAAMAAAARQAGHPASALA
IAAEVLALAD--------------------------------------------------
----------------------------------------APRA----------------
----QVAGITP--SS
>gi|56478620|ref|YP_160209.1|	   409 residues, 50 /line  hypothetical protein ebA5591 [Azoarcus sp. EbN1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MKIVDLIYF-NAGGGHRATAVALGAVLRQR-K-----PEWQVRLVN-LFEVLDPQNR
-YRSITGSAPEDWYNKRLARGWTIGMAPEL-----KLLQTV--IRLAHRPLVKQFQQHWA
QT--EPDLVVSLVPNFNRALFESL----ASALP---------------------GVPHVT
MLTDLAD-VPPNFWIEPDQDQHFICGTPKAVEQARALGHAEERIHATSGMIIRPDFYDVI
R----------LDRARERHRYGL---DPLRP-TGVVLFGGHGS-KA-MLGIAKK------
LAE----------STQLILFCGH--NKALAR--------------QLRA-LPQR----AP
RL--VIEFSLDIPCYMRLADFFIGKPGPGSISEAVQQGLPVIVVE-NAWTM-PQERYNAA
WVRDNHLGIVHGS-FR------TIDRAVAQLL----SQFEKFRVSVRSIDNRALFEVPEI
LDDILDEATR--------------------------------------------------
----------------------------------------IHSDEAQAACH-PPRFLRTS
SSAAAAASTSASLSD
>gi|60679847|ref|YP_209991.1|	   388 residues, 50 /line  N-acetylglucosaminyl transferase [Bacteroides fragilis NCTC 9343]
------------------------------------------------------------
-----------------------------------------------------MMLNLK-
SNMNK-E-----------------------------------------------NNK--E
GQGDALRVIISG-GGTGGHIFPAVSIANAIKELR------PDAQILFVG-AEGRME----
-MQRVPDAGYQIIGLPVAGFDRKHLWKNV-----------A--VLLKLVRSQWKARNIIR
QF--RPQVAVGVGGYASGPTL--K----MAGMM---------------------GVPTLI
QEQNSYA-GVTNKLLAQKARRIC------VAYDGMEKFFPANKI-IMTGNPVRQNLLAEK
-----------PEREQAIRSFGL---NPEKK-TILILGGSLGA-RT-INNTLIAGL---Q
LIRR-------TTDVQFIWQTGKIYHQQVTE--------------AVKA-AGEI----PN
LF--VTDFIKDMAAAYAAADLVISRAGAGSISEFCLLNKPVILVPSPNVAE-DHQTKNAL
ALVNKQAAIYVKD-AE------AENKLLPVAL-ETIANAEKLSELSENIAHLALPDSAVV
IAKEVIKLAQ--------------------------------------------------
----------------------------------------QS------------------
---------------
>gi|67078252|ref|YP_245872.1|	   388 residues, 50 /line  possible UDP-glucuronosyltransferase [Bacillus cereus E33L]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------MER--N
PTQKTILFLPFL-QIPSGHHQVANALMEGIQKD-Q-----LNTKCDQVD-ILSYSYGRIE
--ALVSNIYLKWIKVFPNFYNWIYQISVYK----NVEDNKR--YRLYELLFVPFMRRLIR
DK--QPDLIICTHALPSYILNYLK----EKGEL---------------------KTPIIN
VYTDYF--IHS-CWGIEHIDFHFV-PSHHMKEFLKKKGVNDEQI-FITGIPIHNKIKK--
---------------QKEYIVNT---ASSAW-SVLITGGSLGV-GA-IEDLICK------
IG-M-------ETKIHFYVLCGK--NENLYQ--------------KLQQ-LQRD--NITP
LK--YITCRKKMNKLYDQIDAIVTKPGGVTISESLFKRKPIFIY---HVLP-GQEEINLQ
QLKKLGVIFHLDR-WK------DEKNTIEEQLHSFFQNKNQLQQYQDRITEYHRQLITKE
PSQIIKELIK--------------------------------------------------
----------------------------------------KGGR----------------
-----LSTKID---F
>gi|76259735|ref|ZP_00767380.1|	   386 residues, 50 /line  Glycosyl transferase, group 1 [Chloroflexus aurantiacus J-10-fl]
------------------------------------------------------------
------------------------------------------------------------
------M-----------------------------------------------TNA--M
NRQPIDVLFAIS-DTGGGHRSAAVAISAALEQMSG-----ASITWAIED-LLQATNVPGV
--RSAPGLYDQLSTRWLKLYNFSFQLTN-----SQSTVSFL--SRIVYLIARQNLNRLLT
ER--RPRLVVVTHPLVHRLVCAAR----RRRQH---------------------SFRVLT
VVTDLVT-LHA-SWSYPGVDLALT-PTDEAYRLMHKRGMKPSQL-QRCGFPVHPKFAAEQ
-----------RDAPTARRDLGL---EPDRF-TVLLTAGGVGS-GR-LGELVQT------
LEQQ-------MPDKQFLVVTGK--NRALYE--------------ELRS-GPRL----PH
TH--VFGFVNNMEELMAASDVVVTKAGPGTLMEALVMRKPVIVT---EAVG-LQEHGNID
FVLNYELGFFCPT-NE------RIVAAISQL-----EDPVRYAETVERLKHAVPRDGAIQ
IARVIHQQLS--------------------------------------------------
------------------------------------------------------------
-----LQPVGGS---
>gi|121593616|ref|YP_985512.1|	   388 residues, 50 /line  hypothetical protein Ajs_1204 [Acidovorax sp. JS42]
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------M--A
PEAAPLVELIYF-NAGGGHRTSALALEAAIARA-G-----LPWQVCRTN-LFEVLDPNAR
-FRQWTGMEPEDVYNKRLARGWTLGLTHEL-----RLLQGM--IRWSHQRLMQSLRRHWA
AR--RPAMVVSLVPNFNRAMADAL----EQALP---------------------GVPYVT
VMTDLAD-CPPSFWMEPQTQQIVVCGSPYAVDQARAADFPPHRIWETSGMVLSAQFHAPV
D----------QDRAAERARLGL---D-ERP-VGLVLFGSEGS-RE-MVTIARR------
LTD-----------TPLILACGR--NAALAQ--------------ALRA-LRRN----AP
TV--VLEYTREMARVMQLADFFIGKPGSGSLSEAVHMGLPPIVTR-NAWTM-PQERYCTE
WVGEQGLGLVLPS-FR------SIASGVQALL----ADLPRYQAATRRMHNRAAAEVAQA
LAQILRHAQA--------------------------------------------------
------------------------------------------------------------
-----RAEWAGRWVA
>gi|78061400|ref|YP_371308.1|	   399 residues, 50 /line  UDP-N-acetylglucosamine/LPS N-acetylglucosamine transferase-like [Burkholderia sp. 383]
------------------------------------------------------------
-------------------------------------------------MRAPLRTRLR-
TTFIE-T-----------------------------------------------VSQ--M
SKQNKKILLLSV-SAGAGHTRAAEAIRAFADHH-P-----AGIEATHLD-VMDFVSTGFR
--KLYTDLYIKLVSSQPALWGYLYQKTDEVD--PAAPSQKI--RRAIERLNCRALLAEIE
RQ--RPDAIICTHFLPAELLSREI----RKGRV---------------------DTPVWV
QVTDFD--LHS-MWVVPNMRGYFA-ANDEIAWRMHARGMAPDTV-HVSGIPIMPAFGQPL
D------------RAACAAEFGL---DPARP-TFLMMSGGAGL-GG-LDVLAAR------
LLEM-------DADFQLIALAGK--NKAMLA--------------SLQE-LAAQ----HP
GRLFPQGFTQQVERLMACADLVITKPGGLTTSECLAMQLPMIVN---SPIP-GQEERNAD
FLLEQGVALKAID-DD------ALVYRIHALL----QTPERLADMRRRLAPLGRPLAGRF
VLDRVLGLEP--------------------------------------------------
------------------------------------------------------------
-------------AA
>gi|106886076|ref|ZP_01353424.1|	   461 residues, 50 /line  Monogalactosyldiacylglycerol synthase [Clostridium phytofermentans ISDg]
--MSIVACYFRGISIPLHNVEMRLSYPYEKVP----------------------------
-----------------------------------NNVNKERAFTLQVSAFCV-------
------------------------------------------NLIQKKTKDKVRGILCEV
MEVGMNVLILSC-NTGEGHNAAGRALEEYLKYSG--------EEVEMID-FMKLASERTS
--RIVGGAYVSIAKLTPHFFGLIYQLGMKVSN-KR--HKSP--VYYANALMAKYLSEYLK
KH--SVDILVTPHLYPAETITYM----KKKSLL---------------------RCKTLA
IATDYT--CIP-FWEETNCDAYII-PHEDLIQEFSSRGISREKL-YPLGIPVKKAFCNNQ
ELKICSFDEQNMEYKSVKERLKL---PNNRS-LFLVMSGSMGF-GK-IQLFTFE------
LNRKC------KKGEQIVVICGN--NHKLFR--------------MMKQR----FRYHTN
VH--IIGYTNNVSLYMEAADVVYTKPGGLTSTEVIVKNKPLVHT---APIP-GCETSNME
FFAVKGMALSSHS-LK------NQIQQGMKLM----NCEQMRMGMLNSQVKHSKPNACRD
IYHLMKKMCG--------------------------------------------------
----------------------------------------EDADEISH------------
--------------I

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.