FANDOM



>gi|50058795|gb|AAT69142.1|	   109 residues, 50 /line  hypothetical protein At2g11775 [Arabidopsis thaliana]
------------------------------------------------------------
--------------------MSSENDYTRYLSTQHVLVPSARASRSQGNASRNCDPP---
-----------------------------------SPTSQNQQAGLSPPPSNS-------
NTPNQSHSATQPPTARLNDLTLDELLCNT-------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----PN-P----------------------------------------------------
----------TSIAH---------PICFVRKQS---------------------------
------------------------------------------------------------
PWSPFKPK----------------------------------------------------
------------------------------------------------------------
-
>gi|11994531|dbj|BAB02595.1|	   510 residues, 50 /line  En/Spm transposon-like protein [Arabidopsis thaliana]
------------------------------------------------------------
--------------------MFGGNDYTRWLSQTSGSNPVGGDATSPGNTSAVQDNRQAH
PRHSRRHSGSPAMSTGSPAQSTGSPAQSTGSPALFSGSPSSPATGSPSTPASG-------
SHSSPANQTSQPPSSRLNNLTLDELLVSPVREHLKKLHPKRPPGTLWFGEDGEVAATVRS
IFEKDFKEPHANWTQTPSKVIDRWFETFAQTYNWGRSINARVRSEFDSKLKSRMCDQVCR
WKGKWREIGDDAKPKWIDPEVWAALVKFWLDPKSEAKSINSRKARYHDPDGTGISKHRSG
QTSFKARAR-KHSEKTGELTPDFLQVVEETHRKPDGSFTDGKSESIYKEVSSRIQELESE
LCAGEN-ESSGSGGLSIHTKNKIYTERLLLLVVSEKQLFFESLLCLKTSVAPRKKNRI--
-YGVGSLQQEAASAHSGPPPPAEDHVLLAEKLAHAEAALQAQATQLQKSAEKMHQVFEYL
AKKDLVFAAMFESENESRATNTEANR---------------------------VSTPQTT
PVTPLTGE----------------------------------------------------
--------------------NMGDNPGNGTAT-------------------STASLSKS-
F
>gi|29423668|gb|AAO73428.1|	   249 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
-------------------MPSSENTYPRYRSQQRDPLHV-NSPVSAGNISGVQGSRHP-
-----------------------------------------------PSP--------PT
PTTQPSVNHFDSQAERLNNLTLEELLDSPGRAGLTRLDPKRPPGTLSFDDDAAVAATVRS
IFERDFKEPHANWSQTSKATIDRWYETFAQVYNWDRSINKRVRVVFEAKLKSRMTDQVSR
WKGNWKEKGDEAKPKWIDPDVWKGLVLFWQDPKSEKRVTTAEML------GIMIRMAKAS
INTVQARPHTKLVQENGVR---------------------------------RLE-KKLL
ISLS--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------C----
-
>gi|4263643|gb|AAD15365.1|	   356 residues, 50 /line  En/Spm-like transposon protein [Arabidopsis thaliana]
------------------------------------------------------------
-------------------MPSSENTYARYRSQQRDPLHV-NSPVSAGNISGVQGSCHP-
-----------------------------------------------PSP--------PT
PTTQPSVNHSDSQAERLNNLTLEELLDSPGRAGLTRLDPKRPPRTLWFDDDAAVAATVHN
IFERDFKEPYANWSQTSKATIDRWYETFAQVYNWDRSINKRVRVEFEAKLKSRMTDQVSR
WKGNWKEKGDEAKLKWIDADVWKGLVLFWQDPKSEKRVITAEML------GIMIRMAKAS
INTVKARPHTKLCEKIGEKTPDFLELLDETHRKADGSFIDGKSEEIYKQVTSRIE-RKSL
ICVQGT--------------IRRAL-----------------------DQAERKESQIPR
NCCEGSTRTVVACVLRGKQLLA------------------KFAREL----RLFTICEKRF
AR-----------------NLISSQ-----VPRVWLFAR---------------------
------------------------------------------------------------
-------------------------------------------------------D----
-
>gi|4406803|gb|AAD20112.1|	   365 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
-------------------MPSSENTYARYRSQQRDPLHV-NSPVSAGNISGVQGSRHP-
-----------------------------------------------PSS--------PT
LTTQPSVNHSDSQAERLNNLTLEKLLDSPGRAGLTRLDPKRPLGTLWFDDDAAVAATVRS
IFERDFKEPHANWSQTSKATIDRWYETFASNNNR--------------------------
------------NARYHDPD------------------------------GKGIYKHCSG
QTSYKARVR-KRCEKTGEKTPDFLELLDETHRKADGSFINEKSEEIYKQVTSRIEEEESH
MGSGDNPESTGSGGLSVHAKNKIFT-----------------------EVAPRKKGRI--
-YGVGSLHFEASSAHSGPTLPSDDPVILSEKLAAAEACIQNQAGKI----NNFDILFDYL
AEKDPALAAILRRGSSTQTRPVSAN-----EPPVATAPEQQA------------------
--------NEETAAA----AALANLA-TGS------------------------------
------------------------------------------------------SLSSV-
F
>gi|12322481|gb|AAG51254.1|AC025781_6	   341 residues, 50 /line  unknown protein; 40022-38319 [Arabidopsis thaliana]
------------------------------------------------------------
-------------------MSFTGKDYSRFRSQQQR----GNPHSSEGNTSAVHGTGQNS
RPQTPI----------------------------------NQASGASPQQ--------GN
QSPNGSVNHANPLASRLNDITLDELLDSLGRAGLLRLDPNRPPGTFWFEDDPSVPATVRS
IFERDFKELHANWSMTPQHVVDRWFETFAQMYNWDKTINKRVKTEFEAKLKERMTDQVCR
WKGKWREKGDAAMPRWFDPAVWAGLISFWRDPKSELKSINSRNARLHDPDGLGIHKHRSG
QTSYKAHAR-KRCELTGETTPNFLVLLDKTHRKPDGSFIDGKSEEIYNEVSSRIQEESSQ
LCSNNTTESTASGGGSKEEREDIWG-----------------------------------
------------------------------------------------------------
---------WFIA-ARSR------------------------------------------
----------------------MSSH-WSF------------------------------
------------------------------------------------------SSSRRS
G
>gi|7523390|emb|CAB86448.1|	   389 residues, 50 /line  putative protein [Arabidopsis thaliana]
------------------------------------------------------------
-------------------MSFSGNDYSRFRAQQRG-----NTLVNEGTSSTVQG-----
--------------------------------------------GASPHD--------AN
QSPNGSVNHANPLASQLNNMTQDELLESLSRAGLPRLDPNRPPKTLSFDDDTSVAYTVRS
IFERDFKEPHANWSMPPQSMVDRWFETFAQMYNWDKAINKRVRTEFEAKLKERMSDQVSR
WKGKWREKGDAAMPRWFDLEVWAGL-----------------------------------
------------CEMTGETTPDFLVLLDETHRKPDGSFIDGKSEEIYNELSSRIQEEASQ
LCSDNTTESTASAGLSVQAKNKIYV-----------------------AVAPKKKGRI--
-YGACSLQLEASSAHIGPSVPREDPVEHFQKLPTAEALIANQAEKL----SNFDVYFDYL
ADKDPDFAGLFRA-GSSRTEPLSSNL---------------------------RPEVPNA
TTGTSAEIAHVAVEAETVAAEAVGAN-TGY------------------------------
------------------------------------------------------SPSHI-
F
>gi|12324638|gb|AAG52274.1|AC019018_11	   447 residues, 50 /line  hypothetical protein; 46649-48852 [Arabidopsis thaliana]
------------------------------------------------------------
-------------------MSFSGNDYTRYLSQQQQS---PHTSVSEGNTSAVNGTRRSS
AQQMPTDL-----------------------------NS-NHPDGSAPQP--------QN
HSPQPSVNHSNPLTARLNDMTLEELLESPGRASLPRLDPNRPPGTFWFDDDTSVAATVRS
IFERDFKEPHANWTQTPAPVIKRWFETFAQVYNWDAAINERVRNEFEAKLKDRMSDQVCR
WKGKWREKGDEAKPKWIDPDVWAGLVKFWKDPKSELKSINSRNTRYHDPDGLGIHKHRSG
QTSYKARAR-KRCEMTGETCPDFLVLLDETHRKSDGTFIDRKSEEVYKEVSSRIQEEESQ
LCSGDTTESTASGGLSIKAKNKIYA-----------------------QVAPKKKGRV--
-YGAGSLQIEASSAHAGPVLPGEDPVVLSRKLAVAEATIATQAEKI----TSFDVYFDYL
ADKDPEFAALFRARTSTRTEPTSSNP---------------------------IPEEPNT
AAAPSAGIRDEVVGA----------T-GSS------------------------------
------------------------------------------------------SPSQA-
F
>gi|4263768|gb|AAD15429.1|	   441 residues, 50 /line  En/Spm-like transposon protein [Arabidopsis thaliana]
------------------------------------------------------------
-------------------MSFSGNDYTRYLSQQQQS---PHTSVSEGNTSAVNGTRRSS
AQQMPTNL-----------------------------NS-NHPDGSAPQP--------QN
HSPQPSVNHSNPLTARLNDKTLEELLESPGRASLPRLDPNRPPGTFWFDDDTLVVATVRS
IFERDFKEPHANWTQTPAPVIKRWFETFAQVYNWDAAINERVRNEFEAKLKDRMSDQVCR
WKGKWREKGDEAKPKCIDPDVWAGLVKFWKDPKSELKSINSRNARYHEPDGLGIHKHRSG
HTSYKARAR-KRCEMTGETCPDFLVLLDETHRKSDGTFIDRKSEEVYKEVSSRIREEESQ
LCSGDTTESTASGGYLLRLRTRFML----------------SLL----QVAPKKKGRV--
-YGAGSLQIEASSAHAGPVLPGEDPVVLSRKLAVAEATIATQAEKI----TSFDVYFDYL
ADKDPEFAALFRARTSTRTEPTSSNP---------------------------IPEEPNT
AAAPSAGIRDEAVGA----------T----------------------------------
------------------------------------------------------------
-
>gi|12322629|gb|AAG51315.1|AC025815_2	   451 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
-------------------MSFNGNDYSRFRSQQQN----QRRSPSEGNGSATQGNLQTP
-------I-----------------------------NSNNQANGASPPPVNQSPTGSAN
QSPRGSANHTTPLHARLNDLTIEELLASPGRAGLPKLDPNRPPGTLWFDDDTSVAATVRS
IFEKDFKEPHANWSHTSKAVADRWFETFAQVYNWDPAINQRVRLEFEAKLKDRMSDQVGR
WKGKWKEKGDEAKPRWIDPEVWKGLVSFWRDPKSERKSLNSRNARYHDPDGLGIHKHRSG
QTSYKARTR-KRCEMTGESTPDFLLLLDKTHRKPDGSFIDRKSEEIYKEVSSKIQEEESL
LCSGDTTESTGSGGLSIQAKNKIYA-----------------------QVAPKKKGRI--
-YGAGSLQHEASSAHAGPVLPRDDPVVLSQKLAAAEALIANQAEKI----TSFDAYFDYL
AEKDPEFAALFRARSSSRTEPVSSNP----------------------------PDAPNA
T---AAGIGPEAVEPEAVVA---NPN-TGS------------------------------
------------------------------------------------------SPSEA-
F
>gi|4262159|gb|AAD14459.1|	   562 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
--------------------MVSENDYTRYLSTQQVPVPPTRGSISQGNASRNCDPPSPA
SQ--------------------------------------NQQAGLSPPQ-------SNS
NSPNPSHSATQPPTARLNDMTLDELLDSPGRQSLQKLDPNRPPGTLWFDIDGSIAASVRK
VFERDFKAPHANWTQTPKAVITRWFETFAQMYNWDKSINDRVRDEFENKLKDRMSDQICR
WKGKWKEKGDEAKPKWIDPQVWAGLVRFWRDPASEIRSINSRNARYPDPDDLGISKHRSG
QTSFKSRAR-KHSEETGDLTPDFLVVLEMTHRKPDGTFSDGKSEEIYKEVSSRIEEAESL
LQLGDNIESSASGGLLVAVKNKIYA-----------------------QVAPRKKGRL--
-YGVGSLHNEASSATVGP-QPHNDPVVLSEKLAAAEARLQLQAEKI----NSFDAYFEYL
AEKDPVFAGMYRRP-SEPVNADATRPAEGNQTGGDQTFTDQTETETETRTVGGLQTESLS
ECTDKVRVRHGFLNAYTTTKDAFLSNKSPYRQSYLHVKIREPIEEIMQGLAATTDRGSLS
YLMVIWFIFLCVLLECLRCAMAGSYPQIPIISDAAYIHRRFSLADYWPTALRFPKPKPS-
I
>gi|12321085|gb|AAG50654.1|AC073433_6	   313 residues, 50 /line  transposon protein, putative [Arabidopsis thaliana]
MTVPKKKKHKMNSANLLMALRSSSPVSCFFSAVKNPHRIDPNNGLPENPNFLCLKSSHRV
FSGDNPIFFAASHVSSICKMTFSGNEYTRFRSQKQHQQR-PHTSVSEENTSTVQGNRRTF
APQT--------------------------------------VDGASPPP--------KN
QSPQPFVNHTNPLAARLNNMTLEELLKSPGCASLPRLDHNRLLGTLWFDEDPSVAATVWS
IFERDFKEPHS-W-----------------------------------------------
------------------------------------------------------------
------------------------------------TFIDRKSEEIYKEVSSRIQAEESH
LCTGDTMESTASGGLSVQAKNKIYAQ-FLVGCSEEER-----------------------
--------------------------KHYKKIVALRGNIARE------------------
-EIPRKFARVLQV----------------------------------------ICYETDA
RCIPVAKLRGKY------------------------------------------------
------------------------------------------------------------
E

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.