Fandom

Proteins Wiki

At2g11370.1/PDB

< At2g11370.1

47,922pages on
this wiki
Add New Page
Talk0 Share
&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g11370-2e3l_A.pir.txt

======================================================

Assigned types to 130 residues in Sequence 2-11370, 7 remain unknown
Assigned types to 73 residues in Sequence 2e3l_A, 64 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 22  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 23  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 24  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 25  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 26  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 27  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 28  All residues are positively and negatively charged

Translated sequence file At2g11370-2e3l_A.pir.txt into sequence alignment.

======================================================

>2E3L.pdb  Made from 1475 ATOM records in 2E3L.pdb
GSSGSSGLRKAVEDYFCFCYGKALGTTVMVPVPYEKMLRDQSAVVVQGLP
EGVAFQHPENYDLATLKWILENKAGISFIINRPFLGPESQLGGSGPSSG

======================================================

Best alignment:
2E3L.pdb    44  VVVQGLPEGVAFQHPENYDLATLKWILENKAGISFIINRPFLG    86
                 V   LP  +   H +   +  ++ +L      + ++  P LG
2-11370     32  TVSSSLPNDMVVPHIDGQFIKDVEAVLTTPDWANLLVLNPSLG    74

======================================================

Highlighted IDENTICAL residue VAL   45  index1   45  path   40  %Seq 100.00
Highlighted IDENTICAL residue LEU   49  index1   49  path   44  %Seq 100.00
Highlighted IDENTICAL residue PRO   50  index1   50  path   45  %Seq 100.00
Highlighted IDENTICAL residue HIS   57  index1   57  path   52  %Seq 100.00
Highlighted IDENTICAL residue LEU   70  index1   70  path   65  %Seq 100.00
Highlighted IDENTICAL residue PRO   83  index1   83  path   78  %Seq 100.00
Highlighted IDENTICAL residue LEU   85  index1   85  path   80  %Seq 100.00
Highlighted IDENTICAL residue GLY   86  index1   86  path   81  %Seq 100.00
Highlighted 8 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g11370-2e3l_A.pir.txt.2E3L.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g11370-2e3l_A.pir.txt PIR amino_acid 2E3L.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.