FANDOM


>gi|15227446|ref|NP_178892.1|	   130 residues, 50 /line  unknown protein [Arabidopsis thaliana]
MWVNSAVTVQFATKHSRNLENFPAKRNLSRQTVSSSLPNDMVVPHIDGQFIKDVEAVLTT
PDWANLLVLNPSLG----------------------------------------------
-----------------------------TWVDRTTV--TLYWDNMRALKRGWACGLDKP
WWMTTTVWNDLVDMFTEFGPDDVGFTS
>gi|15224870|ref|NP_178941.1|	   151 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------------------------------MVPHIDGLFLRDVEAVLTA
PDRADLPVLNPGLGTWVDKTTVTWFKFNHQLAVTIGDILQRNFHHAWPTYRMIPVVFKAS
TLC---------------MHTWDSRHTLTVWTQFNLVARTLYRDNMRAMKRRWARGLDKS
RWMTTTVWNDLVDMFTEFGPDDVGFMS
>gi|22327327|ref|NP_680326.1|	   147 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------------------------------MVPHIDGQFLRDVEAVLTA
PDR--------GLGTWVDKTTVTWFKFNHQLAVAIGDILQRNFHHAWPTYRMIPVVFKAR
WFFLLT-----------RMHTWDSRHTVTVWTQFNLVARTLYRDNMRVLKRGWARGLDKP
RWMTTTVWNDLVDMFTEFDPDDVGFMS
>gi|9279568|dbj|BAB01026.1|	   103 residues, 50 /line  En/Spm-like transposon protein-like [Arabidopsis thaliana]
----------------------------------------MVVPHIDGQFIKDVEAVLTA
PDRANLPVLNPGLG-------------------------------------YIYLGFKAH
---------------------------LNEWTQFNLVARTLYQDNMRALKRRWACGLDKP
WSMTPTVWNDLVDMFTEFGPDDVGFMS
>gi|15230793|ref|NP_189670.1|	   144 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------------------------------MVPHIDGQFLRDVEVVLTA
PDRADLPVLNLGLGTWVDKTTVTWFKFNHQLAVAIGDILQRNFHHAWPTYQMIPVVFKAR
WFFLLTISIEFLYKALS----------------------NVVPGQYAGAETRWARGLDKP
RWMTTTVWNDLVDMFTEFGPDDVGFMS
>gi|5732025|gb|AAD48926.1|AF147259_11	   141 residues, 50 /line  contains similarity to an Arabidopsis thaliana hypothetical protein (GB:AF058825)
-----------------------------------------MVPHIDGQFLRDVEAIFSS
KPWIGY-----------------MGRQNH--------CYVRNFHHAWPTYRMIPVFFKAR
WFLLLTVSIEFLYKALPRMHTWDSRHTLTVWTQFNLVARTLYRDNMRALKRGWARGLDKP
RWMTTTVWNDLVDMFTEFGPDDVGFMS
>gi|15231459|ref|NP_189698.1|	   111 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------------------------------------MVVVPHIDRQFLKDVEAVFTA
RARVNLPVPNPGLGTWVDRTTDTWFRFNHQLSVAIADILQRNFHYAWLTYQMILVVFKAR
WFF-------------------SSRHTLTVWTQFNLVARTLYRDD---------------
--------NSL---------------E

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.