Fandom

Proteins Wiki

At2g11090.1/MSA

< At2g11090.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|15227386|ref|NP_178874.1|	   151 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
-----------------------------------------------------MLH--IC
VD----FSQ-----VDASRHQQTTRPR-------------GRVEDLSTSRHHST------
--------------------------------------------------------PWSS
TTWTT--------------------------------------------TRSHYSTPWSS
IITS-T--------TSPSLDHTTQPRGRVPSSP---------------------------
---------SLDHSTT--KPSTTIPI-TRLHTRLPASE------------S-------SP
FCTQPDTRAEGRKE-----------------DSSLSLDHSLDHLGR--------------
-----------VPFLIRRNTTSF-------------------------------------
-------------
>gi|116830063|gb|ABK27989.1|	   108 residues, 50 /line  unknown [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------MRSS
VFTS-I--------IRQPLDLLTLPRGRVSPPHHSTAYSMTSFR----------AFFILH
---------STRHSST--MKKRRLQLFTRPITRPCGSS------------TVL---NPSK
YFVVLGIRVSGYLA-----------------ISSMYFSFSKGRSF---------------
------------------------------------------------------------
------------G
>gi|42571747|ref|NP_973964.1|	   150 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------MIMTNHST------
--------------------------------------------------------TRSS
R---------------------RHHHFTSPLDPEVECHHLHHQTL----TRSLHSTMRSS
VFTS-I--------IRQPLDLLTLPRGRVSPPHHSTAYSMTSFR----------AFFILH
---------STRHSST--RKKRRLQLFTRPITRPRGSS------------TVL---NPSK
YFVVLGNRISGYLA-----------------ISSMYFSFLKGRSF---------------
------------------------------------------------------------
-------------
>gi|42573503|ref|NP_974848.1|	   256 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-MFR--------------------------------------------------------
----------------------------------------------------IVLH--AC
CI----FAL-----ISGDLELLTSHLE----------------EADLITTNHST------
--------------------------------------------------------KRSS
RSFKI-PRDQSTPRSSI-----GHHHFTSPLDLFTPPGSRVSSNT----TRSPHSTPRSS
AFTF-T--------ARPLLDLITLPRGRVPPSHRSTAYSMTSFR----------AFFIPH
---------STRHSST--RKKRRLQLFTRPLTRPPGSS------------TVL---NPSK
YFVVLSIRVSGYLA-----------------ISSMYFSFSQTRSFY--------------
-LVLFPQTLCSRLFVIRISLYLFSIQLWFLI----FVYCCSFCY-HTTVTLLLSC-----
-LQPVQRLCF-LL
>gi|15230833|ref|NP_189692.1|	   206 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-MFR--------------------------------------------------------
----------------------------------------------------IVLH--AC
CI----FAL-----ISGDLELLTSYLQ----------------EADLITTNHST------
--------------------------------------------------------KRSS
RSFRI-SRDHSTHRSSR-----GHHHFTSPLDHEIECPHLHHQTI----TRSLHSTMRSS
AFTF-T--------ARPLLDLVTQPRGRVSPSQHLTAYSMTSFR----------AFFIPH
---------STRHSST--RKKRRLQIFTRPLTRPPGSS------------TVL---NPSK
YFVVLSIRVSGYLA-----------------ISSMYSSFSQTR-----------------
---------------------------SFLP---------SFISADLVF-----------
-------------
>gi|9884623|dbj|BAB02629.1|	   57 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
-MFR--------------------------------------------------------
----------------------------------------------------IVLR--AC
CI----FAL-----ISGDLELLTSYLE----------------EADLIMKNHST------
--------------------------------------------------------KRSS
RSFKI-SRDHSTPRSF--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------
>gi|15230834|ref|NP_189693.1|	   206 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-MFR--------------------------------------------------------
----------------------------------------------------IVLH--AC
CI----FAL-----ISSDLELLTSYLE----------------EADLITTNHST------
--------------------------------------------------------KRSS
RSFRI-SRDHSTHRSSR-----GHHHFTSPLDHEVECPHLHHQTI----TRSLHSTMRSS
AFTF-T--------ARPLLDLVTQPRGRVSPSQHLTAYSMTSFR----------AFFIPH
---------STRHSST--RKKRRLQLFTRPLTRPPGSS------------TVL---NPSK
YFVVLSIRVSGYFA-----------------ISSMYFSFSQTR-----------------
---------------------------SFLP---------SFISADLVF-----------
-------------
>gi|22327209|ref|NP_680270.1|	   258 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-MFR--------------------------------------------------------
----------------------------------------------------IVLH--AC
CI----FAL-----ISGDLELLTSYLE----------------EADLIMTNHST------
--------------------------------------------------------QRSS
RSFKI-SRDHSTTRSRR-----GHHHFTSPLDPEVECPRLHHQTN----TRSRHSTSRSS
AFTF-T--------ARPLLDLITLPRGRVSPSHHSTAYSMTSFR----------AFFIPH
---------STRHSST--RKKRRLQLFTRPLTRPPGSS------------TVL---NPSQ
YFVVLSIRVSGYLA-----------------ISSMYFSFSQEEVSY--------------
-LVLFPQTLCSRLFVIRISLYLFSIQFLYLI---------SFTVVHSVIILLLHCCYHVF
NLFNVYAFCY-DV
>gi|123227308|ref|XP_001285974.1|	   171 residues, 50 /line  hypothetical protein TVAG_341870 [Trichomonas vaginalis G3]
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------TPHST------
--------------------------------------------------------PHST
PH----STPHSTPHSTP----------------HSTPHSTPHSIP----MTTPHMSQRYQ
PIKI-E--------DTDSLSQINEEKLSIEKKSNAVIYAAVAIG----------CFLLLT
LTIVLTLYYTKRHVRN--AGTASSSISVQDIQ----EG------------TVI---NPE-
----IDGEDDDLLS-----------------KVPLWTKTIENPGPF--------------
-ITEFEEDEVGYFFMIA-------------------------------------------
------ANAF-NN
>gi|29648986|gb|AAO86835.1|	   108 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
--------------------MVEYHLD---------------------------------
------------------------------------------------------------
------------------------NHSITLXDPLVEYHHVHHITF----TRSHYSTTWSS
TFIT-F--------TRSLYH-----QAEYHHPYHSTTYSTASXR----------VFSILH
---------STRHSSR--RKKRRLQLITRPLTRPPGSS------------AVL---NPS-
------------------------------------------------------------
------------------------------------------------------------
-------------
>gi|9279787|dbj|BAB01208.1|	   134 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
MDIQ--------------------------------------------------------
----------------------------------------------------KRPK--YD
SN----KKKFLMV-LGISRFHHITRPP-------------GRV-----------------
------------------------------------------------------------
----------SSPPPP-------DHHSITPLDPEVEYLHLHYQIT----TRSSHSTKKSS
ISIT-T--------TR-----------------------------------------LPT
--------------RW--RASESSPFRTQPDTRAQG------------------------
-----------RKE-----------------DSSYSLDLSLDHRGR--------------
-----------VQFLIRPNTASF-------------------------------------
-------------
>gi|4773910|gb|AAD29780.1|AF147259_3	   267 residues, 50 /line  F10A2.13 gene product [Arabidopsis thaliana]
-MAN--------------------------------------------------------
----------------------------------------------------VSKHLGSS
CIRIACFGVFSG--VEGAKKDFTRSIH-------------SIQAATEEASIHSTSLLDPG
CYRGGYSLLDPLTRSRQPQMKQQIDLLAPPTRSIYSTTAVDELIGRSGPDRIKPLDPLSS
TCFTT-STNHSTPSSSR-----RPRHFAPPLDHMAEYHQLHHLTI----TRSHHSTPWSS
TSIT-F--------TRSLTRLHGRPSITIS------------------------------
--------------------------ITRIYTRLPALE------------S-------SP
FRTQPNTRAQGRKE-----------------DSSSSLDHSLDHLVEF-------EPRHFR
AQKVFDEMSEP---LIPEIRGSVPRLTL----------------VNG-------------
------------D
>gi|8778797|gb|AAF79805.1|AC020646_28	   177 residues, 50 /line  T32E20.17 [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------MRDQENKPT-------------SLRNPEKEGRVHSSPSLDLS
LYQHGRVT------------------------------------------------PSSF
------TRPITLPTGRV-----TPSSFTRPITRPTTLPHGRVHSS----PSLDHSTTEPS
TIIS--------------------------------------------------------
--------------------------ITRLNTRLPASE------------S-------SS
FRTQPDTRAQGRKE-----------------DSSLSLDLSLDHLARHVLYIFENKFKKKS
FYLVFPQTLCSRPFVIRISLYLFSIQLL--------------------------------
------------F
>gi|123337223|ref|XP_001294321.1|	   162 residues, 50 /line  hypothetical protein TVAG_318700 [Trichomonas vaginalis G3]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------MHSTPHSTPDSTMHSTPHST------
--------------------------------------------------------PHST
PD----STMHSTPHSTP----------------DSTMHSTPHSTP----DSTMHSTPHST
PDSTMHSTPHSTPH----------------STPHSTPHSTPHST----------PASTPH
---------STPHSTP--ASTPASTPATTPADTPAI--TENEAAQAFGSTTFI---VPMT
IVLIVTISLIVVFA-----------------LIA--------------------------
------------------------------------------------------------
------NQSCWRW
>gi|42570737|ref|NP_973442.1|	   173 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------MPTTSPSLNHST------
--------------------------------------------------------NRSS
ITIIIHSTNHTTNMVEYHHHH----SLDQSLYQQVEYHH-------------HHSLDQSL
YQQVEYHHHHSLDQ-------SLYQHGRVPPLSFTRPITL----PPSRVLP---------
------------------------PPSTRPITLPHGRVPYHHSLDVFTRLPAS---ESSP
FRTQPDTRAQGRKE-----------------DFSLSLDHSLDHLGR--------------
-----------VLFLIRPNTASF-------------------------------------
-------------
>gi|15221112|ref|NP_174876.1|	   212 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-MLRTVARESNHISEELLVE-----------KKYDSIRENEASANEFEEEDEIANNEDDV
VTKEAAALEANNDNEKKDDIYIGMEFSSDQIAYITYKKYGGNHGFNVGKQRKM-------
-------KK-----REGDLELFASKLEETSQNQKTYSTPWSS------------------
------------------------------------------------------------
DFEAI-LPIHSTTRSSN----LSSGHSMTLLDPLVEYHFAT-------------------
------------------------------PSPSLDHSLYQVTRPPGQVSSLTTISITRP
---------DTRSRLHSLLKSALN------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------
>gi|8778803|gb|AAF79811.1|AC020646_34	   240 residues, 50 /line  T32E20.7 [Arabidopsis thaliana]
-MSSLMMHCLIHVPELMNVKGIGRFESMCRSSIRDGLIDNKAWLTFLSRIQSYRILELPT
WTMILFALSY---------ALCPFIMVLSPVSYHSSLFYIISHHSCILCMIRIVLH--TY
YI----SEL-----FSGDLELFASKLEETSQNQKTYSTPRSSDFGAILP-TYST------
--------------------------------------------------------PRSS
DFGAI-LPIHSTTRSSN----LSSGHSMTILDPLVEYHFAT-------------------
------------------------------PSPSLDHSLYQVTRPPGRVSTLTTISITRP
---------DTRSRLHSLLKFALN------------------------------------
------------------------------------------------------------
------------------------------------------------Q-----------
-----------TS
>gi|15235658|ref|NP_192473.1|	   207 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------MHCLIHIPELMNVKGIGRFESMC-------------------------------
------------------------------------------------------------
-----------------DLELFASKLEETSQNKKTYSTPRSSDFGAILP-TYST------
--------------------------------------------------------PRSS
DFGAI-LPIHSTTRSSN----LRSGHSMTLLDPLVEYQFTTPPDNTRPFTLPHHSTPRSS
ITSP-HHHHHSTIHSTKLLDPLVEYHHS-PPSASLDRTLDHVFT----------VYSNPH
---------STRQAEHKEEKRRRQSVWKRPGLPSDHEA-------HLGPLSLY---G---
------------------------------------------------------------
------------------------------------------------P-----------
-----------SD
>gi|22328390|ref|NP_680613.1|	   193 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-MIR--------------------------------------------------------
----------------------------------------------------ITLH--TY
CI----SEL-----FSGDLELFASKLEETSQNQKTYSTPRSSDFRAILP-TYST------
--------------------------------------------------------PRSS
DFGAI-LPIHSTTRLSN----LSSGHSMTLLDPLVEYHFATLPDNTRPFTLPSYSTPWSS
IITH-HHQHHSTGHSITSS--------------------------------QSTQIRTQP
---------D--KLSTR--KRR--GEDKVFGSGLDLHR-------IKKPISAH---Y---
--LSMGRAIRLLA-----------------------------------------------
----------------------------------------RLLSFYFVL-----------
-----------YK
>gi|15226716|ref|NP_178834.1|	   169 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
---------------------------MTSPLH-NTTRPPGRVVTFTASIHHST------
--------------------------------------------------------TWSS
TTIIIHSTNHSTNRSSITIIIHSTNHSTNKCSITIIIHS------------TNHSTTKSS
STI----------------------------IHHSTSYSTASLR----------VFSIPH
---------STRQSSI--RKKRRLQQITRPITGPPRSS------------IVL---NPSQ
YCVVLSIRVSEHFA-----------------ISSLYFIFSRKK-----------------
-----------------------------------------FSSADTV------------
--------CY---
>gi|22329987|ref|NP_683367.1|	   261 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-MSS--------------------------------------------------------
----------------------------------------------------LMMH--CL
IY----VPELKNVKGFGDLELLASKLEEESRNQKPHTRPPGRV----HPAPHST------
--------------------------------------------------------PWSS
NIGAV-LANHSTPWSSN----HTPGYSMTPLDRIGKQHFV----T----PLDNHLTIHST
T----------------LLDPLVEYHHS-PPIKSLDQALDHTFR----------VFSNPH
---------SNRQAEHKAEKRRRRSVWKRPGASPDHKA-------QFGPLSFY---GPKM
FDGMLDPLVPEILV-----------------SIPRDWPFRALGELT-------DSSTELG
ELI--------KCKVERVPTNGCIAQRM--------------QGIDVTFRKD------AK
NGCDISEGCKDRM
>gi|9294211|dbj|BAB02113.1|	   174 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
-MIR--------------------------------------------------------
----------------------------------------------------IALH--TY
CI----FEL-----FSGDLGCWRGNWKKRART-RRHTRPPGRV----HPTPYST------
--------------------------------------------------------PWSS
DIGAI-LPIYSTPWSSN----HSSGHSMTPLDPMVEYHYT----T----PLDHHSAIHST
TS----------------LNPLVEYHHS-TPTPSLDQTLDHIFK----------VYSNSH
---------LTRQAEH--KDEKRRR---RSVWKRSGAS----------------------
------SDHEAHLG-----------------PLSLYGPV---------------------
------------------------------------------------------------
------------D
>gi|123480116|ref|XP_001323213.1|	   164 residues, 50 /line  hypothetical protein TVAG_446920 [Trichomonas vaginalis G3]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------MHSTP-------------------------------
---------------------------------HSTAHSTPHST----------PHSTPH
---------STPR----------YTISPSASIAPAISS------------VNLGENSTET
MNIITGTQTKKKNWLPIIIGAIVGFLLLAAIIAFLIFWFKKREESSDDSICEMQEETVIN
YNMTEGATITNDNPLWKTSITLDISDDPFKNDFEEAEAAEDFFAVREKF-----------
---------LDEN
>gi|15226655|ref|NP_178822.1|	   175 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
-----------------------------------------------------MLH--IC
VDFRGR--------------------VGASRSQ-ETTRPPGRVEDI--------------
------------------------------------------------------------
--------------------TTSLHHSTTRSSAL--------ISI----TRSHHSTMRSS
VFTS-I--------IRQPLDLVNQPGSRVSPDKHLIT-----------------------
---------SLDHEVE--CLHLHCQTTTRPHCSTWKSS------------ITI---TPLD
CILDDKLQSLLHSA-----------------LNQTLEHRKGKKTPATHSTSHST------
-----------------------------------TWVEYSSLSVPILR-----------
---------RFEY
>gi|42570721|ref|NP_973434.1|	   158 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
-----------------------------------------------------MLH--D-
-----------------------------------LNRPLDPLVE---------------
------------------------------------------------------------
--------------------YHHESHSITSLDHLVEYHHLHHLTI----TRSHHLTTRSS
IFIT-V--------TRSLYHQV-----EYHHLHHSTSYSVASFR----------VFSIPH
---------STRHLST--RKKRRLQLITRSFTRPSGSS------------TVF---NPSQ
YCVVLSIRVSENFA-----------------ISSMYFTF---------------------
-------------------------------------SMKEFYSVDTVF-----------
---------LTFL

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.