Proteins Wiki

Diff selection: Mark the radio buttons of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

31 July 2007

  • curprev 17:0717:07, 31 July 2007Guliping talk contribs 1,124 bytes +1,124 New page: <pre> >gi|22325598|ref|NP_671821.1| 249 residues, 50 /line unknown protein [Arabidopsis thaliana] MRAIIQTLEGNLLLLRSRIVDKSSTNKVVDESMVTVKRLSNVNKGAKDMNLVGTRSTTPS SAFAKNRWVLSPKKTKEIKEFHTKL...