Fandom

Proteins Wiki

At2g10965.1/MSA

< At2g10965.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|22325598|ref|NP_671821.1|	   249 residues, 50 /line  unknown protein [Arabidopsis thaliana]
MRAIIQTLEGNLLLLRSRIVDKSSTNKVVDESMVTVKRLSNVNKGAKDMNLVGTRSTTPS
SAFAKNRWVLSPKKTKEIKEFHTKLVVGISHKRIEKFMLKLDPNPGSNGEWEVLEVGKWA
NIGDRAHQRKPSIPDCWARSVGSAAATVERVNKLHDGSGAEAITTANGLAKERRRSLREP
KGPADL---VTMRRRRQGSGWKDWSPMKLKASQT------VFFD---------------S
QGLDRECSLLGGHILPMSENTASKKIQQQRRTR
>gi|116830437|gb|ABK28176.1|	   72 residues, 50 /line  unknown [Arabidopsis thaliana]
MRAIIQTLEGNLLLLRSRIVDKSSTNKVVDESMVTVKRLSNVNKGAKDMNLVGTRSTTPS
SAFAK-------------------------------------------------------
------------------------------------------------------------
-----------VRTRFWG------------------------------------------
---------------------------------
>gi|22325534|ref|NP_671798.1|	   245 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---MNQTHGGNLVLVRSRIVDNTSTNKAAREKVVTVTRRSNVNKGAKDKSLVGTRSTTLS
RALAKKSIA-----AKEIKEFHTKLVVG-----------KLDPNSGRKDGWDVLE--EHS
NEGDSPFKWCP-----WPLKTEKRRLHWDRLCKLQKETNLGLI--GKGLGSQNMGLGRRG
NGPTMVIGPIKANPRNQIAGQEALEARRLRWRGTDRVVGADIFDKARVRGRYGDGDKSQN
RKVERKWSRKIQSLLSLIRKVLAESVDGSEATV

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.