FANDOM


>gi|42570745|ref|NP_973446.1|	   282 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------MTTYVTFCFLQNSLKFASNHKKHYNLPSS--------------
-------------------------------QRTHNLKK---------------------
---RK-PPPLF---------------MSI-------------------------------
------------------------------------------------TYLRHLSS---N
LLVSKK----TKICREMIEVVITKG--TMIDAIC------------------------PY
FYPGYDVPRVFD--KGGWFFLENIHLIK-SAVGRKRPL-TDNKLRIKFLQTTKLSPVD-R
L-----------------------------VP------------NAYGVVVRVENI-TRP
DF-----------------VPQVSENPILSQFLEFEI-----KNT-----WGKSLICVAR
GYTCELFVQLWMELGLDLGYQWTFGMNPTN-----CVLRFWNVDDH--------EGR-QC
LIS--HNGAS-----KITFNQ-SYPEINMDRIT-----------TQFLERMQ--PPEL--
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------GEVVDE----------------
------------------------------------------------------------
-------------------N
>gi|10177990|dbj|BAB11363.1|	   197 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------MSDFQVVV-NTMPV--RY-SFCSKQIKFLRGTNMWPVP-S
LS-TSR--FFEFVA-PIDVKNA-APQDMDFLF------------DAVSIIIRVSNS-RRF
PF-----------------VCRQRETYYQTRYVKFTI-----ADN-----MEKKIRCIAV
GQMCEWFVNHWSKRISLI----TYNYEPIV-----AVLQNWRITNY--------HGK-NV
LHS---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------EFGFSKLYINP
KSKEIDIPNYL-----------------------------------------------HG
YMIEDD-EDDIMMEVV-EKN
>gi|42570693|ref|NP_973420.1|	   231 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------MLIDSKY--NRIDATI------------------------QE
GTILWKYKDVLK--DGFWYYMSDFRVVV-NTMSV--RY-SFCSKQIKFLRQTTMWHVP-P
LS-RSR--VFEFAA-PSDIENA-APQDMEFLC------------DAMGIIKWVSNI-RRF
PF-----------------VCRPRETDYEARYVKFTI-----ADN-----VGNEVICIAV
GQICDWFVNHWLKRINLI----TYNYEPIV-----VVLQNWRITNY--------HGN-NV
LMS---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------DWGFSKLYIDP
KFEEIDIPTWL-----------------------------------------------HG
YMIEDE-EDDVMMEVV-DEN
>gi|124360115|gb|ABN08131.1|	   185 residues, 50 /line  Nucleic acid-binding, OB-fold, subgroup [Medicago truncatula]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------MVLMDASG--NKIHATV------------------------RR
-TLIYKFEKDLQ--EGKVYSMSGFGVAA-NLGSY--RT-TKHEYKLNFQFNTKVKLCG-K
NS-VPD--DIYPIS-NSIVVFN-SEYDTDYLV------------DVMGMLTGVGMQ-REY
E-----------------------RNGAKTKMVAMKL------NY-----DGFKFKVTLF
GQYADELNAFVAA----------GETNKVI-----VVVLLAKVKIW--------QGN-I-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------FFFCNP
KFIFYC------------------------------------------------------
-------------------S
>gi|42569031|ref|NP_179041.2|	   237 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------MDGYHSVSE---------------------
---LC-PTISG---------------WTI-------------------------------
------------------------------------------------CVFVVMEF---K
KFVAPD----EFDLG--LILADRTGPRSRIKATI------------------------PR
R-LASFYFDRIREYEYEWIIITNFSVRN-DAESV--RA-TSHDYQIWFMEQTIATKAL-R
TD-ALS--FWNFT--PFDNIIE-KTVNKYVLV------------DAVGAIIWQGRL-TE-
--------------------------GIDGVKFSFKI-----MNQ-----HSEVLYCEAH
NQQALDFQAHFQSL----------CSPAIV-----AVLVCWRVSGH---------SK-PK
LVS---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------HGPVSKVFGNL
EIPEVDKIYVV-------------------------------------------------
-------------------F
>gi|15220268|ref|NP_174829.1|	   231 residues, 50 /line  replication protein-related [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------MW---D
LQSMIK----PTPCT--MILCDVKG--NKIDARI------------------------PW
GEYMSNFKTSLF--EGKWYYLQHFRLKR-STTIP--KY-TDFHYEIEFMWHTKMWAVS-D
RA-EQS--SLQFIH-ADEVNGE----SEDHVV------------DVIGVITTVSTV-SSF
PY-----------------CCPEGETDYDARYVTFTI-----RDN-----HERIITCVAR
GSACESFLSKVYRLIGSK----TYNYEPLT-----TVLRFFRTSMF--------KGS-KA
LIS---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------EYGCSRVFIEE
EFPDFDVSCYM-----------------------------------------------Y-
---------VKDIRY----W
>gi|42570695|ref|NP_973421.1|	   258 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------MAERNYIPD---------------------
---LN-LHTNN---------------HVL-------------------------------
------------------------------------------------HVKILSIW---D
LQSMNK----PTLCT--MILCDVKG--NRIDARI------------------------PW
GEYMNNFKTTLF--EGKWYYLQHFRLKR-ATTIP--KY-TDFHYEIEFMWHTKMWHVS-D
RA-KES--SLQFIH-QDEVNGE----SDDHVV------------DAIGVITTVSTV-SSF
PY-----------------CCPEGESNYEARYVTFTI-----RDN-----HERIITCVAR
GSVCESFLSKFYQLIGSK----GYNYEPLT-----TVLRFFRTSMF--------KGS-KA
LIS---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------EYGCSRVFIEE
NFSDFDVSCYM-----------------------------------------------Y-
---------VKDIRLL--FL
>gi|15240109|ref|NP_198526.1|	   269 residues, 50 /line  replication protein-related [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------MADTNYIRD---------------------
---LS-LHRNN---------------HVL-------------------------------
------------------------------------------------YVKILSIW---D
NQSMIF----GTPTT--MILYDVKG--TRIDTRV------------------------PW
GDYLNNFKPSLF--EGKWYYIADFRLKR-ATSIP--KY-SSFNYEIEFMWHTKMWPVS-D
RS-DES--SLQFIH-ADEIESE----SEDYVT------------DAIGVISSVSTE-ARF
PY-----------------VCREGETDYEARYVTFTI-----RDN-----LDRIITCVAR
GSACESFLTKFYRLIGMK----TYNYEPIT-----TVLRFFRASNF--------KGS-KA
LIS---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------EHGCSRIFIEE
SFPDFDVTVYI-----------------------------------------------NW
FACEDDGSVEGKIEYF-VEN
>gi|15229196|ref|NP_189884.1|	   303 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------------------MA-------------------------------------
-------------------------------ASFAFLRD---------------------
---IR-PYKTS---------------WRI-------------------------------
------------------------------------------------QVKVFHSW---R
QYTSMT----GETLE--LVLVDAHG--VKIHASV------------------------KK
-DLVSNFVNNLL--LNEWRFIETFALNH-ASGQF--RP-TGHLYKMTFVTGTQC------
-----------------------------ILL------------DVMGQVVDIGEL-ETL
E-----------------------AKNKPTIKLDFEL-----RDD-----TDERMSCTLW
GAFAQSVFSACEF----------ADGQMVI-----CVLRFAKIKSY--------KGV-RS
FSN--SFYAS-----QVHINP-DFPEVQAFVSRVP----------KFH--MV--TVKQDD
DCKQYERKSIRDFLHSMEV-----------------------------------------
------------------------------------------------------------
-----RVVC---------TIYALDTDWSWYYFSCRNCNKKVTHIH--------AG--VNT
T-------SLKSSKPRFW-----------------------C------------------
-DVC--KNGVTNVQA----K
>gi|15229218|ref|NP_189896.1|	   269 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------MMLANP-------------------------------------
-------------------------------LPFTPLKS---------------------
---LK-PYKNA---------------WRI-------------------------------
------------------------------------------------QVKLLHVW---R
QYSVKA----GESIE--MILVDEAG--DKMYAAV------------------------RR
-EQIKKFERCLT--EGVWKIITTITLNP-TSGKY--RI-SDLKYKIGFVFKTTVSPCD-S
VS-DAL--FLSLAK-FDVIL-S-GSANSNILH------------DVMGQVVDRSEI-QDL
-----------------------NANNKPTKKIDFHL-----KDQ-----HDTRLACTLW
GKYAEIVDQACQE----------STDGIVV-----CLIRFAKINLY--------NDS-RS
VSN--SFDVS-----QVFVDP-TLAELALFKQR------------SFHKRLY--APRTGD
DDGDYPRQTISAY-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------K
>gi|20198228|gb|AAM15471.1|	   251 residues, 50 /line  putative replication protein A1 [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------MYAAV------------------------RR
-EQIKKFERCLT--EGVWKIITTITLNP-TSGQY--RI-SDLKYKIGFVFKTTISPCD-T
VS-DAL--FLSLAK-FDVIL-S-RSANSNILH----------------------------
------------------------------------------------------------
-------------------------------------------------------DS-RI
VSN--SFDVS-----QVFVDP-TLAELGLFKQSIPTDGLTLGSSGSFHKRLY--APKTGD
DDGDYPRQTIKEVLTSSDIGRGTIFVVVLTTRRLSKRKLSNLKMSSYLRSQDFGVKYAMV
LQKSVVAK----------------------------------------------------
-----------------ENIFGGYDSFTVVRVYTGNIADEIVQED--------SDAYVDP
S-------SLISIEH---------------------------------------------
-------------------V
>gi|42568998|ref|NP_178844.2|	   352 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------MMLANP-------------------------------------
-------------------------------LPFTALKS---------------------
---LK-PYKNA---------------WRI-------------------------------
------------------------------------------------Q-----------
------------------------G--DKMYAAV------------------------RR
-EQIKKFERCLT--EGVWKIITTITLNP-TSGQY--RI-SDLKYKIGFVFKTTISPCD-T
VS-DAL--FLSLAK-FDVIL-S-RSANSNILH----------------------------
------------------------------------------------------------
-------------------------------------------------------DS-RI
VSN--SFDVS-----QVFVDP-TLAELGLFKQSIPTDGLTLGSSGSFHKRLY--APKTGD
DDGDYPRQTIKEVLTSSDIGRGTIFVVVLTTRRLSKRKLSNLKMSSYLRSQDFGVKYAMV
LQKSVVAKFWLHFHIMDKTGEARCMLFDSHAKEILDRR--------------PTVLLDVI
NGLKGKTFQFL-LCIQRENIFGGYDSFTVVRVYTGNIADEIVQED--------SDAYVDP
S-------SLISIEHAST-----------------------SRK-----K----------
---C--SKMTMSEEGSG--E
>gi|4558677|gb|AAD22694.1|	   345 residues, 50 /line  putative replication protein A1 [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------MYAAL------------------------RR
-EQIKKFERCLT--EGVWKIITTITLNP-TSGQY--RI-SDLKYKIGFVFKTIVSPCD-S
VS-NAL--FLSLAK-FDVIL-S-GSANANIF-----------------------------
---------------------------------------------------DTRLACTLW
GKYAEIGDQACQQ----------LTDGIVV-----CLIRFAKINLY--------NDN-RS
VSN--SFDVS-----QVFVDS-TLDELGLFKQSIPIDGLTLESSGSFHKRLY--APRTGD
DDGDYPRQIIKEVLTATYIGRGTIFVVVLTTRRLSKRKLSNFKMSRYLKSQDFGVTYAMV
LQNLLLPSFGYISILWNKLGK-------------LDAC--------------YSIVMQWI
-------FLAL-LPLNCLM-------VHLMRVYTGNIADEIIQED--------SDAYVDP
S-------SIVSIDQVPL-----------------------CSL-----MVLI-----FL
MWIC--HQPLFHHQNEK--I
>gi|4263051|gb|AAD15320.1|	   330 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
-----------------MDNTLR-------------------------------------
-------------------------------TPFLSIFGTIGSFVCSGFATRATWTTLSR
TWLSP-PYKNA---------------WRI-------------------------------
------------------------------------------------QVKLLHVW---R
QYFVKA----GESIE--MILVDEVG--DKMSAAV------------------------RR
-EQIKKFKRCLT--EGVWKIITTVTLNP-TSGH---------------------------
------------------------------------------------------------
---------------------------------------------------DTRLACTLW
RKYAEIVDQACQK----------STDGIVV-----CLIRYAKINLY--------NDN-RS
VSN--SFDVS-----QVFVDS-TLAELSLFKER---------------------------
------------------------------------------------------------
--------FWLHLHIMDQTGEARCMLFDSHVNDILGTTVPELLNGLFDEIEDPTDLPDVI
NGLKGKLFQFL-LCMQRENIFGGYDSFTVAIFYTGNIDDDIVFED--------SDAYVDP
S-------SIVSIDQVCL-----------------------ITLNNSNHLYLY-----FM
VVLL--KYVLYFHIGFPYAH
>gi|15238447|ref|NP_198376.1|	   272 residues, 50 /line  replication protein-related [Arabidopsis thaliana]
------------------------------------------------------------
-------------------------------MSVYKLTD---------------------
---LR-DNSTN---------------WKI-------------------------------
------------------------------------------------NVKILSIW---N
HPPNSH----GEIMT--MILHDDKN--NRVDATI------------------------PQ
GNYHNPFRPFLK--PGTWIHISDFRVIV-PQSRV--RY-SSFCFHIKFIWETSVYPLP-E
LV-KRD--FFDFIF-PIDLKYP-CLEDWDYVT------------DAMSEVTNISAI-KKF
PF-----------------VCRQGETDYESRYVSFEL-----LDN-----MGEKMKCYAV
GRCCELFVINFSKCISSA----SYNYQPIV-----AIVRFWRIAEI--------EGE-NV
LKS--EFGCS-----RIYLNPTNFPEIDIQSYI-----------RGFEDYDELPENPR--
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------MEVIEE----------------
------------------------------------------------------------
-------------------N
>gi|9759293|dbj|BAB09780.1|	   236 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------MILCDEIG--TMIDAIC------------------------AY
FYTGYDVPRVLN--EGGWFFLENILLIK-SVVGRKPSL-TDNKLRIKFLQTTKMTPLP-N
RE-PSS--FFRFAA-FSMIE-N-KTINSSAVH------------DAYGIVVRVGNI-TRP
DF-----------------VPQASENTILSHFLEFEI-----KNS-----WGKSLICVAT
GYTCELFVQLWRGLGLELGYHWNFGMNPTI-----CVLRFWNVDDH--------EGR-QC
LIS--HNGAS-----RITFNQ-SYPQINMDRVR-----------TQFLQRMQ--TPEL--
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------DEVVDE----------------
------------------------------------------------------------
-------------------N
>gi|6598585|gb|AAF18640.1|AC006228_11	   259 residues, 50 /line  F5J5.17 [Arabidopsis thaliana]
-----------------MANEKKMLPKRIILMRHGEISVYYIIYIY--------------
-------------------------------IY-IYLCE---------------------
---VN-KLDSI---------------Y-I-------------------------------
------------------------------------------------YI----------
-----------------YIILLYIF--CMSTNTIRININFYIESNLFIYLPFSMEIYSPP
YIYEHNIPRVLE--EGSWYFMENIHVIKVSVGSP--PF-TDFKFKIKFLPNTKMS-----
------------------------------LV------------DAYDVVVRVENI-TRP
DY-----------------VPQDFENPRLSQFLEFEL-----RNT-----WGKSLTCVAS
GYTCDLFVHLWRDLGLGLCYKWTFGMNPTT-----CVLQFWKISDH--------EGR-QC
LIS--HNGAS-----RIVFNQ-NYPEINMTHIS---------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------
>gi|89257613|gb|ABD65101.1|	   226 residues, 50 /line  hypothetical protein 31.t00082 [Brassica oleracea]
-----------------MSQFTL-------------------------------------
------------------------------------LAN---------------------
---LD-LSIKN---------------PTV-------------------------------
------------------------------------------------RV----------
-----------------KVISKWRG--VTIQGTI-------------------------R
DAFPKSFETIMN--EGEWFGITNFKLEH-SFGRV--RM-TKNRYNVILSEKSIIFKSE-P
TT-YCN--YYAFKP-FGSII-C-GLAHPMYCI------------DLYGALVGVGSL-ETY
VL-----------------QGDGVGDNSLDNKLVFSL-----INP-----EFIQIKCIAY
GSTARELHAYWSS----------IRANVIL-----CVLTFWQIQWG--------EGGFRF
MTN--LEGCS-----KIMFNP-SIPEIEAFKKK---------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------
>gi|15242763|ref|NP_198309.1|	   192 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------------------MA-------------------------------------
-------------------------------ASFAFLRD---------------------
---VR-PYKTS---------------WRV-------------------------------
------------------------------------------------QVKVLHSW---C
QYTNMT----GETLK--LVLVNSQG--VKIHASV------------------------KK
-DLVSKYVNNLP--LNEWTFIETFALNH-ASGQF--RP-TGHLYKMSFVTGTQVIRCD-S
VS-NSS--YLSLAT-FANIQ-T-GDSNPAIL---------------VGTLTHLGTM-EHN
------------------------------------------------------------
-------------------------------------KEFWKLFSN--------KVL-EG
RFS--EGGVD-----R------HHTCVDRHSYCC--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------QGNSRFLPS--L
>gi|5732045|gb|AAD48944.1|AF147262_7	   357 residues, 50 /line  contains similarity to Xenopus laevis replication protein A1 (SW:RFA1_XENLA) [Arabidopsis thaliana]
MQIPIRKHYIGKFHMSLKVGDWMIIDTFTLSPSYGKYKISSLSYRMGFNHNTDVIKCDPV
SDSVFLDLAYFEGVKTESYDENVLIDILGQVVSVGKVDD---------------------
---IMAQNKPNKKLEIQIRDARQVGQWRILGSIFAIDTDLAEIKLMVFENNATKLIGQTS
EVLVDGQYEEIEDPTIIPDVITNLCGKTFHFLVSVEKANIYGGKDIYKVTKLLKLW---N
WPPNYF----GEERI--IILVDEKG--TRIDDRV------------------------PW
GDYLNNFKPSLF--EGKWYYIADFRLKR-STSIP--KY-SSSTFEIKFMWHTKMWPVS-D
IS-TES--SLQFIH-ADEVEYE-YEDY---VT------------DAIRVISSVSTV-ARF
PY-----------------VCREGETDYEAIYVTFTI-----RDN-----L---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------
>gi|15229275|ref|NP_189923.1|	   235 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------MEGFHMVSE---------------------
---LC-SLITG---------------WRI-------------------------------
------------------------------------------------YVFVVRVF---K
KVISPN----VFELG--LILADYAN--NRIEATV------------------------DR
-RLAPFYEDRFV--ENEWKTITSFLVRK-STDSV--RA-TKHEYGILFMYRTVVVQAP-P
RSPPVP--DFDFDPFDYILEKSA---YKNVLV------------DVVGALVDVGAL-T--
-------------------------TDYYGLKLSFEI-----KDR-----YNKVLECEAR
NQQAEYLDGY-FQSLGK---------GNFV-----VALSFWRLTEL--------SNP-K-
LES--HGAIS-----KVVANP-DRPEVA--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------DISMV-------------------------------------------------
------------------VF
>gi|124359862|gb|ABD32456.2|	   327 residues, 50 /line  Nucleic acid-binding, OB-fold [Medicago truncatula]
------------------------------------------------------------
----------------------------MMYAKYTPISA---------------------
---VS-EGRKN---------------LKM-------------------------------
------------------------------------------------CVRVAHIWLIRE
KKVPTS----IIFMN--MLLVDEKG--GRIHATA------------------------RK
-DLVAKFRSMVQ--EGGTYQLENAIVDF-NESPY--KV-TSHKHKLSMMHNSTFTKVH-S
LAIPMN--VFEFKP-FNEILSS-TVEE--VYT------------DVIGHVIERGNI-RE-
----------------------TEKDGRKSRVIDLTL-----EDL-----ENNRLHCSLW
GEHVDKIVTFFGNH---------DNDTPTI-----LILQFCKTRMY--------LGV-MG
VAN--AFNGT-----KLILNG-DLPDVAVYMTRMK-------------------------
------NASIQFIRSVSQ----------------------------ISTNSSASLSDDLL
NTNQ---------------------------------------MTIESMIESTELYVAIS
RVTS---------------------------------------------RGGLKILINDD
DGDDTDVASS--------------------------------------------------
---------VIYREVS-RNV
>gi|15231182|ref|NP_187934.1|	   272 residues, 50 /line  replication protein-related [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------METMHHLSD---------------------
---LH-VHSTN---------------WRV-------------------------------
------------------------------------------------YVKILALY---N
HNPTLN----GDETT--MLLVDEKS--SRIDAKI------------------------PE
GSYLYKFRDVLR--IGVWYYMSDFQVVL-SQSEV--KY-ALRPIHIKCLFHTQMWPVP-S
RS-SRR--FFDFAA-PDEVKYA-TDDQFNCVT------------DAIGVIVKVYPI-RSF
PF-----------------VCRQGETDYESRYVAFKI-----KDN-----MGNAIKCVAI
GKYCEEFVNKWFTRTSLI----TFNYEPIV-----AVLNFWRITNY--------HGS-NV
LMT---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------VDGISRLFIDP
KFNDINIPSYI-----------------------------------------------RG
FSDLNEADNDLMMEVV-DEN
>gi|42570697|ref|NP_973422.1|	   251 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------MLNFKTFSD---------------------
---LR-PKKTR---------------AFV-------------------------------
------------------------------------------------FVKILRLW---N
WPPNYF----GEEPT--MILVDEKG--HRIDAKS------------------------SR
HAYKEEMISTLR--EGKWYILSNFKVVV-ANPLE--RF-STHVFQIEFLKKTTMEPVT-P
KS-RYH--FIECVD-FHTIKHA-APIQKKFVV------------DAMGVIESVSPI-GKI
PW-----------------VARDWESDFASRYLVFTL-----KDS-----MHKYIKCVAV
GSSCEEFERKWYKKISEP----NFKMEPVM-----IILRFWKISEF--------EGK-PC
LIS---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------VYGCSKVHIDP
NFRGIDKNNYL-------------------------------------------------
--------------------
>gi|4263647|gb|AAD15369.1|	   339 residues, 50 /line  putative replication protein A1 [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----M----SKFVN--QLIVDE-------------------------------------
------------------------------------------------------------
----------------------WIFIEK-FGL------------NYAGQIVMIGEL-EDL
E-----------------------TNNKPTKKIDFEI-----RDE-----MDERLAVTLW
SSFAEHVFRSC------Q----ESDGKIVV-----YLLRFSKIKAY--------NGV-RS
LSN--SFDSS-----QVHVNP-PFPEVDVFVRSCKVCKKKVT------------------
------HIYMMGCMVSIT----------------------------KERNHVYGVTCASM
WSQML-------LLVIDNTGEAKLLLFDSICSEIIGESSAFVLDGSVEEIEDPDVLHDPV
KNLIGKTFLFLRIYGMRKEIYK-----VSKVLLKDGLLDDQLLEDSAEIVNAASIVSGDQ
SKLEFDAEGVIRGAATPNTLIVGDERVDIKKKGTVVELDEEVTVDRGSVELII-----VK
KEAV--KKEVFKVKVE-KKE
>gi|22327272|ref|NP_680300.1|	   251 residues, 50 /line  replication protein-related [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------MAPVQKISD---------------------
---LN-VYSSR---------------WSV-------------------------------
------------------------------------------------YVKVLCIC---D
HPPTMY----GDVTT--MILIDDKC--NRITATV------------------------PK
GNYLYNFKRVLK--EGFWFHISHFRVIS-LVHTL--KY-TCSPLHIKFKWDTFVSPIP-E
VE-KSD--FSDWI-FPSDLENS-STDNDLDVT------------NAVGVVSSVSSI-KRF
LY-----------------VCRQGETDYAARYVAVEI-----MDN-----WEQKIKCIVV
GKCCELFVTNWFRRISRP----TYNYEPVV-----CAVRFWRIAYV--------QGE-NV
LLS---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------EPGCSRLDIDP
SFPHFDLASYM-------------------------------------------------
--------------------
>gi|6272376|gb|AAF06082.1|AC007918_6	   270 residues, 50 /line  F28J9.7 [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
--------MIW---------------FDE-------------------------------
------------------------------------------------KVFIICIR---N
HC-------------------------------Y------------------------RS
KRQVYKFRHFLK--EGFWYHISHFRVIS-STNKF--KY-TANPLHIKFKWDTSVWPMS-E
LK-KCS--FTDWI-FSIDLEYS-SLENVSDM---------------LLVWCQVCLLFRGF
PMFVARMRSIMSPDMLNLNLCIIGNKKTSAVLLGNAVNGLLRNGI-----GNKKFKCIAV
GKCCEWFVNKWSRRICRP----TYNYEPIV-----CVVRFWRISEL--------EGE-NV
LMS---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------EFGCSRLDIDP
RFPYFDLASYILQVTTMTKF-----------------------LLPSYFVNTS-----RS
FKDD--DDEDVTMEQV----
>gi|15220266|ref|NP_174827.1|	   261 residues, 50 /line  replication protein-related [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------MAYIHKLED---------------------
---LNLMNNQN---------------WVI-------------------------------
------------------------------------------------CVKVLSIW---D
HPPNLN----GDVTT--MILVDAKH--HRIVATI------------------------RR
LNLREKSRRVLQ--EGLWFNISQFRVIP-STHRV--ETYVLNRLHIMFRWDTVVFKMS-E
LV-KSD--FTDYL-FPNELEDS-ATDNVVDVT------------DAIGVVASVSSI-KRF
PY-----------------VRNKGETDYEARYVSFEL-----MDN-----WEQKLKCVAV
GSICEEFVTKWSRRITRS----TYNYESVV-----CAVRFWRIASV--------DGE-NV
LKS---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------EFGCSRLHIDP
SFPYFDFASGV-------------------------------------------------
-----------SKMLM-IKK
>gi|42570763|ref|NP_973455.1|	   260 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------MNNQN---------------WVI-------------------------------
------------------------------------------------CVIVLCIW---D
HPPNVN----GDVTT--MILVDAKH--HRIVATI------------------------PR
LNLRDKFRRVLQ--EGFWFNISQFRVIP-STHRV--ETYVLNRLHIMFRWDTVVFRMS-E
LV-KSD--FTDYL-FSNELEDS-ATDNVPDVT------------DAIGVVASVSSI-KRF
PY-----------------VCNKGETDYEAKYVSFEL-----IDN-----WEQKLKCVAV
GSCCEEFVTKWSRRITRP----TYNYEPVV-----CVVRFWRIASI--------DGE-NV
LTS---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------EFGCSRLHIDP
SFPYFDLASYL-----------------------------------------------RS
FKDA--DDQEVTMEPV-TEA
>gi|124361162|gb|ABN09134.1|	   243 residues, 50 /line  Ribosomal protein L33; Nucleic acid-binding, OB-fold [Medicago truncatula]
------------------------------------------------------------
------------------------------MERPKEFIA---------------------
---AVTDKKDL---------------WKL-------------------------------
------------------------------------------------SVRVKDKW---T
AVKD-G----KEHLE--LLIVDAKG--HDIQLLI------------------------PT
A-YKSVYDKTLE--VNSTYTLTNFQVLK-NDVLF--KV-SDHKYKLIWTGGTTAVDVNLN
DI-PNT--HIKYKPFAEIVFGKWR---PDLLF------------NVIGVVQDMGYC-QL-
--------------------NEGKKLQFSTNLNSFRV-----MIL-----SDIVLNCTLW
EEYAAKFVQYNS-----D----RKEAGPVI-----VLLKYCKIKE---------EGF-NS
LLDF--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------SCFFNYLFRGQNRKCPILHGV
EP----------------------------------------------------------
-------------------Y
>gi|140061857|gb|ABO81925.1|	   306 residues, 50 /line  Peptidase M, neutral zinc metallopeptidases, zinc-binding site; Nucleic acid-binding, OB-fold [Medicago truncatula]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------MVIVDAKG--TDVQVVI------------------------PT
A-YKAETDKMIE--ENTTYTLSNFLVLT-NDLFF--KA-SDNKYKLIWTGRTTVVDPNVH
DI-PDN--DLKFKPFVEIVAEKWHVNNTFFTS------------DVIGYVHEIGHC-QV-
--------------------NQGVS---KKLQVNLTL-----KDL-----SDISLNCTLW
EDYAAKFIKFNN-----D----NKESGPVI-----LMLKYGKIKE---------EGK-YP
LSITNTYGAT-----KMLFNA-DISHIKTLPKNDQMMTQSQV------------------
--------------MCTQ----------------------------SSAGSQFSTDDDLL
SNPL------------------------------------IMPLSDILQLEQISYV----
-----------------------------VTVAKIEKVNSTKFGWYYLACYKCGKIAKGD
NPPYTFEKGHN-------------------------------------------------
---T--ETEIVRYKLE-LDV
>gi|11994532|dbj|BAB02596.1|	   218 residues, 50 /line  replication protein A1-like [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------MKFFHDFEL---------------------
---IN-PSITG---------------WYV-------------------------------
------------------------------------------------RLRVVRSL---V
VHLNAL----SKIVG--LVLADEHG--VMVDAMI------------------------EK
-EFADYYNKFID--AGDWITIMRFGVYP-NLNPV--RV-TSHKFKICFFKDTVVRKTT-A
V-VANP--HYALTYFSSIIDDEI---DTSVLI------------DLVGAIHDVGEV-ENT
R---------------------RTQNVVNDLRICFKL-----KNK-----INCVLECLAS
GKQALDFSQNY-HSLGG---------GVIV-----AVLGWWKLDHYFD----GPKNV--Q
I-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------
>gi|15219513|ref|NP_175123.1|	   237 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
-----------------------------MDDGYHAISE---------------------
---LC-PMITG---------------WSI-------------------------------
------------------------------------------------RAFVVRVF---Q
KCVGIN----EFDLG--LILADNRGMRSRIETTI------------------------NR
-CLASFYSDRIR--ENEWIVINTFSVRL-HNEGI--HA-TSHDYRICFMDQTIVTKVS-G
L-PAIP--YYDFTPFDYIIERTV---STRVLV------------DVIGALIEVGNL-TE-
--------------------------DYRGRKLPFKI-----MDK-----HKEVLQCEAQ
NDQAFEFQRFF-QRLTG---------PQNI-----IALVSWRLT--------GIHKL--K
AVT--NGPIS-----KVIANP-DI------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--PEVEEIRVVV------------------------------------------------
-------------------Y
>gi|15227179|ref|NP_179226.1|	   233 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
-----------------------------MDDGYHAISE---------------------
---LC-PMITG---------------WSI-------------------------------
------------------------------------------------RAFVVRVF---Q
KCVGIN----EFYLG--LILADNRGLRSRIEATI------------------------NR
-RLASFYSDRIR--ENEWIVINTFSVRL-HNEGI--HA-TSHDYRICFMDQTIVTKVS-G
L-PAIP--YYDFTPFDYIIEKTV---STGVLV------------DVIGALIEIGNL-TE-
--------------------------DYRGRKLPFKI-----MDK-----HKEVLQCEAQ
NDQAFEFKDEC-FTYTT---------NYVS-----DELCKDECF---------------T
YTN--TYRHG-----RCEMNC-NG------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--VQFTIGRSVL------------------------------------------------
------------------HE
>gi|15225143|ref|NP_178694.1|	   189 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------MRSRIEATI------------------------NR
-RIASFYSDCIR--ENEWIIINTFSVRL-HDEGI--HT-TSHDYRICFMDQTIVTKVL-G
L-AAIP--YYDFIPFDYIVEKTV---STGVLV------------DVIGALLEVGNL-TE-
--------------------------DYRGLKLPFKI-----MDQ-----YKEVLQCEAH
NDQALEFQRFF-QRLTG---------PQNV-----IALVSWRLS--------GIYKL--K
TLS--NDPIS-----KVIANP-DI------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--PEVEEIRVVV------------------------------------------------
-------------------Y
>gi|15224640|ref|NP_180062.1|	   248 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
-------------------------------MGYDGLRD---------------------
---LN-PCITC---------------WTI-------------------------------
------------------------------------------------CVMVLRKY---V
LFITDN----SFELR--VVFVDEWG--IQIEAII------------------------GT
-RFSQRYYDMLE--ENQWKEIRTFGVIE-NWGFV--RT-TTHKYMIEFMNATEVTHSD-P
R-ETVL--FNRFTPYDYITEDTS---DTDYLV------------DLVGALVEVGCL-RNI
T---------------------KDGWEMDGFRLTFQI-----MDK-----YKERLKCEAS
GELAVDLHRKF-RYFRN---------DSIVIDNIYVALTWWKIFRYHP----GPNHV--K
IQN--HLMIS-----DVTVDP-NI------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--EEVQELKMVL-E----------------------------------------------
--------------------
>gi|15235797|ref|NP_192512.1|	   248 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
-------------------------------MGYNGLRD---------------------
---LN-PSITC---------------WTI-------------------------------
------------------------------------------------CVMVLRKY---V
SFFTDN----SFELR--VVFVEEWG--IQIEAII------------------------GS
-RFSQRYYDMLE--ENQWKEIRTFGVIE-NCGFV--RS-TTHKYMIEFMNAIEVTHSD-P
R-ETVL--FNRFTPFDYIIEDTA---HTEYLV------------DLVGALVDVGCL-RNI
T---------------------EDGWEMDGFRLTFEI-----MDK-----YKERLKCEAL
GELAVDLHRKF-RSFRN---------DNIVIDNIFVALTWWKIFRYHT----GPKHV--K
IQN--YAGIS-----DVTVDP-NI------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--EEVQELKMVL-E----------------------------------------------
--------------------
>gi|42568979|ref|NP_178740.2|	   219 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------MENYHRLYE---------------------
---LS-PLITG---------------WTI-------------------------------
------------------------------------------------CVMILRIY---K
KMLNDH----SFELH--LILQDEAG--KRIEVTI------------------------GT
-RFSAFYYDRLI--ENQWKMISTFL-----------------------------------
--GTVL--LNNFTPFDYILEHSV---RKDTLV------------DLLGALIDFDWL-TNS
A---------------------PNGSDMDGFKLQFRF-----IDSKFTIYSQDILQCEAH
GEYAVDLEKKF-RSVRN---------NKVV-----IALAFWKIVTYFD----GGHRM--K
IAS--HAPIS-----TVYPDP-DI------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--EPVKEIKMVCIY----------------------------------------------
--------------------
>gi|15239279|ref|NP_198454.1|	   252 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------MVKHHHLYE---------------------
---LS-PMVTG---------------WTI-------------------------------
------------------------------------------------CVMVLRIY---K
KFLNPN----AFELR--LVLADEWG--TQIEATI------------------------GP
-RFSAFYFDRIK--ENQWKTITTFLVRP-NCEAI--KT-TPHQFHILFMDHTIVTSST-P
R-ETGL--LNKFTPFDYIVDDVV---GNDTLVDISNIS----LIDVIGALVNVGIL-TNT
A---------------------SNENDMAGFKLPFTI-----MDK-----NKDTLVCEAY
GEIAVDLEKRF-RAFRK---------NNVV-----IALAWWKIIRFYP----GCNWF--K
IVS--HAPIL-----TMYPEP-DV------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--EEVEEIKMVV-D----------------------------------------------
--------------------
>gi|15242005|ref|NP_198250.1|	   354 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------MVKHHHLYE---------------------
---LS-PMVTG---------------WTI-------------------------------
------------------------------------------------CVMVLRIY---K
KFLNLN----AFELR--LVLADEWG--TQIEATI------------------------GP
-RFSAFYFDRIK--ENQWKTITTFLVRP-NCEAI--KT-TPHQFRILFMDHTIVTSST-P
R-ETGL--LNKFTPFDYIVDDVV---GNDTLV------------DLIGALVNVGIL-TNT
A---------------------SNENDMAGFKLPFTI-----MDK-----NKDTLVCEAY
GEIAVDLEKRF-RAFRK---------NNVV-----IALAWWKILRFYP----VAAIP--E
VYL--LAPML-----AKIVSY-VAESGVDSLKSFVKAGLLFKAAVYSKETL---------
SCVRLDRSWYF-------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------MLAF
HMCELQEAIAIL-DGIKDVFPHAGLLYIMLHSCAGSIPWEFYRMYKRRYYKFSEVDLFAD
KLMFHINEVGPRRQGTYKNS
>gi|4699943|gb|AAD28056.1|	   240 residues, 50 /line  putative replication protein A1 [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------MIQFHRLYE---------------------
---LS-PLVTG---------------WAI-------------------------------
------------------------------------------------CVMVVRVY---K
KILNHD----AFELR--LLLVDKLG--TQIEATI------------------------GP
-RFSAFYYDRIK--ENQWKTITTFIVRP-NCEAI--RT-TPHEFRILFMEQTVVTPST-T
K-ETVV--LNNFTPFDYIIEDTV---RKYTLVDLTTVIFIIFRPDLLGALVDYGFL-TNN
A---------------------RNDS----TSLYQHY-----KKT-----GKRRLQS---
---------------AT---------TNVV-----VTLYDYLATDLRL----ACDNT--K
NCS--YIVVVLRLSYAVGKES-AS------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--NDYLMIKLLK-G----------------------------------------------
--------------------
>gi|18412967|ref|NP_567304.1|	   195 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------MFNYHLLNE---------------------
---LS-PLITG---------------WTV-------------------------------
------------------------------------------------RVIVLKKY---K
IFQRGD----SFELR--VIIADETR--MRMDVTI------------------------YR
-SFSSFYFDKLK------------------------------------------------
----------------------------ISGS------------DLVGAVVEVGIL-SHS
G---------------------DPDVGVEGMIVPFKL-----MDR-----YKEVLDCEAT
GRKALEFDTCY-RRYGH---------PKIV-----LALAWWRVVREPELVGGRKNKV--K
IVS--YGAVS-----SVYPEP-SI------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--EEVEEIKMVRA-----------------------------------HLRFTSMD----
------------------HI
>gi|42565359|ref|NP_189832.2|	   202 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------MVNYHLLNE---------------------
---LS-PQITG---------------WT--------------------------------
------------------------------------------------------------
------------------------G--TGIEVTI------------------------HR
-RFSAFYFDKIF--ENKWIGLTNFKVIP-NSDPV--KT-TSAEYGINLMDKTVVTSGD-P
N-TPIK--FNNFTSFDNILEGTF---ENDQLV------------DLLGAVIEVGIL-SHS
G---------------------DPDVGVEEMVVPFKL-----MDI-----YKEILDCEAT
GRKALEFDTCY-RGFGH---------PKIV-----VALAWWRVVRESELVGGRKNKV--K
IVR--YGAVS-----T--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------
>gi|5732026|gb|AAD48927.1|AF147259_12	   216 residues, 50 /line  contains similarity to a family of Arabidopsis thaliana hypothetical proteins; see GB:AL022580
------------------------------------------------------------
------------------------------MFNYHLLNE---------------------
---LS-PLITG---------------WTV-------------------------------
------------------------------------------------RVIVLKKY---K
IFQRGD----SFELR----------------ITI------------------------HR
-PFSAFYFDKIY--ENKWIGLTNFKVIP-NSDPV--KT-TRPEYGIYLMDETVVTSVD-P
N-TAIK--FNNFTSFDNILEGTF---DTDQLM----------------------------
----------------------------------FSF-----CN-------KEVLDCEAT
GRKALEFDTCY-RRYGH---------PKIV-----VALAWWRVVREPELVGVRKNKV--K
IVS--YGTVS-----SVYPEP-SI------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--KEVEEIKMVRT-----------------------------------HLRFTRMV----
------------------HI
>gi|15226797|ref|NP_178848.1|	   194 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------MG--LILADE-------------------------------------
-HMLDHYKDFIN--EREWVTITSFGVVD-NQSPV--RP-TTHAFKIRFAVDTVVILTS-P
V-PAIL--HYRLASFSSIIDDEI---DTSVLV------------DLVGAIYDVGEL-INT
R---------------------LKQNHVDYLTLTFKI-----SDN-----ENRVLECLAT
KKEALDFDHNY-RRYGG---------GVIV-----VVLGWWKIDRYFD----GPKNV--R
VCT--AGPIS-----TVFPDP-DI------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--PKSNQIHE--------------------------------------------------
-------------------M
>gi|15238449|ref|NP_198378.1|	   205 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------MG--LILADEHG--MTIEATV------------------------GY
-KMSDHYKDFIN--EGEWVTITNFGVVE-NSGSV--RA-TTHSFKIGFSVDTVVKLTS-P
V-HAIP--HYRLASFSSIIDDEI---DKSVLV------------NLVGAIYDVGEF-INT
R---------------------PKQNIVDDLTLTFKI-----SDN-----ENRVLECLAT
KKEALDFDHNY-RQYGG---------GVIV-----AVLGWWKIERYFD----GTKNI--R
VCT--ACPIS-----TVFPDP-DI------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--PESNEIHE--------------------------------------------------
-------------------M
>gi|2624702|pdb|1JMC|A	   246 residues, 50 /line  Chain A, Single Stranded Dna-Binding Domain Of Human Replication Protein A Bound To Single Stranded Dna, Rpa70 Subunit, Residues 183 - 420
------------------------------------------------------------
--------------------------GSHMQSKVVPIAS---------------------
---LT-PYQSK---------------WTI-------------------------------
------------------------------------------------CARVTNKS---Q
IRTWSNSRGEGKLFS--LELVDESG---EIRATA------------------------FN
-EQVDKFFPLIE--VNKVYYFSKGTLKI-ANKQF--TA-VKNDYEMTFNNETSVMPCE-D
D-HHLPTVQFDFTGIDDLENKS-----KDSLV------------DIIGICKSYEDA-TKI
T---------------------VRSNNREVAKRNIYL-----MDT-----SGKVVTATLW
GEDADKFDG-------S---------RQPV-----LAIKGARVSDFG------GRSL---
--S--VLSSS-----TIIANP-DI------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--PEAYKLRGWFD-----------------------------------------------
--------------AEGQAL
>gi|87241182|gb|ABD33040.1|	   224 residues, 50 /line  Nucleic acid-binding, OB-fold, subgroup [Medicago truncatula]
------------------------------------------------------------
-----------------------------MSTKHNFISN---------------------
---VS-PRKQS---------------WTL-------------------------------
------------------------------------------------VVRVVRAW---F
GQNYKNK-KLPFSME--LVLIDRKG--DRIGASI------------------------RR
-TLIYKFKNQLQ--EGMVFTISSFNVAS-NIGSY--RP-SRNEYKLNFTINTKVKLSK-T
VLVPTN--VYSFTPAPNVFNESY---DNNYLV------------DVIGVMIGVGVE-KEY
E---------------------RDG--------------------------TYRFKCTLF
GEYVEELNSFL-SSGES---------QNVV-----VAIMLTKVKLFQ------------A
FLV--QYKFS-----YIGIDP-VT------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--KFISHTC---------------------------------------------------
-------------------K
>gi|92884972|gb|ABE87567.1|	   268 residues, 50 /line  Nucleic acid-binding, OB-fold [Medicago truncatula]
------------------------------------------------------------
-----------------------------MYFPLSGLMS---------------------
---PK-TGRMN---------------WSV-------------------------------
------------------------------------------------KVRLLRMW---N
VESSIVA-GKVNSLE--LILLDREG--NKIQASV------------------------PL
-QCIEVFNHILE--ENRGYVFSDFHVVS-NIADM--MT-THNSHRLIFHSNTEVIFTD-I
PA--IDKFGLSIHGSEAISKHVF---GYSYLV------------DVIGFLTDVHPE-YVD
D---------------------PFG--RLSTVLRFEL-----TNLRSFSLCNGRFQCALY
GKVVRSFQLMF-DKVSE---------GLPV-----VVLQLARIVRDGG-------SI--I
VQS--VKNIT-----RVFVNP-DF------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--EEASRSRMRDL-----------------------------------------------
-LAKRKRSKKVKKIRCCHRG

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.