Fandom

Proteins Wiki

At2g10390.1/MSA

< At2g10390.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|15226751|ref|NP_178841.1|	   194 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-------------MSTSSKCLHSITQP------------------I--------------
------------------------------------------------------------
------------------------------------------------------------
---------N---TQRKIARLYIPEPILALIVSHVSEEGIEALKNWIKSGHEGKSAAFSV
ETLSRVRLDKSPDFINMSLPDSVHFSFYSKCLAKQNPYAMYLQSLRLGFCSLDLIGAISL
LNDCKDVIPIAKLLYIALNRCAGNEVLDA---FNTFK----RENKCFT--DVDIMAKTLI
GHISDSDPKRFGSYAELFYY----------------------------------------
--------------------------------------------------
>gi|116830537|gb|ABK28226.1|	   223 residues, 50 /line  unknown [Arabidopsis thaliana]
----------------------------------------------MAKPELPDEILVDI
VRRVGKASCLHMGAF--------------------LRAGSRGLVQVYSKEVLMEANLDEL
CVEPPQIFSKS-INP-------------INGFIFEAGLGRCFFERCLHYENPTAV-----
------------------------------------------------------------
----------------------------------------YFESLRLVTREQDLDGALAM
VASLVPYYSSPTFAYAMFLLCAGKFEIADE-IFKTFFVVHA----CERTKEIREIGEKLF
EDFKGFYPPSQNTFGDKWV---YLNTDTLSF-PECAQ-----WHY-----YRISCDD---
------------YYLFWCYFA----------------------------G
>gi|15229138|ref|NP_189856.1|	   220 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------------------------------------------MSLADLPDDIFQII
VKKFGDEDAYYLAPV--------------------ILTNKQGRDIGLSKEVVQSANLTAL
CLEPQKIF------P--------------C------GVARTFFTHCLDVENHQAV-----
------------------------------------------------------------
----------------------------------------YYEALRLITRERDISGSLAL
LNQLVPTHESANVAYAMFQMCAGRGDLAGATFDMIFDELGDRLWFNNYSPDLEMECEGLI
ETLFSYEPPNEDTFDPIWE---FAYSERICV-RDCA--------YWYEE--EFYCEG---
------------CYIFNAALRICEI------------------------L
>gi|15242051|ref|NP_197576.1|	   220 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------------------------------------------MSLSDLPDDIFQII
VKKLGDEDFNHLGPI--------------------IRSNKRGRDIGLSREILKSANLMGM
CLHPPNIF--------------------------PGQLFRNFFVRCLEFENATAM-----
------------------------------------------------------------
----------------------------------------YYEAIRLIVREENVMGSLFL
LNQLVPTYDYATIAYAFFQMCAGRGDLAGTTFDTIFEQNSVSRWGSIYSFELEVKCEALI
DTIMDFQPHFGMTFAPDWK---FASSDCLSI-SECPD-----WH-----GVEYFCEG---
------------CYIYYVALRILEV------------------------L
>gi|89257675|gb|ABD65162.1|	   203 residues, 50 /line  hypothetical protein 40.t00047 [Brassica oleracea]
------------------------------------------------------------
--MVGADSFYYLGGI--------------------LRAGKRGYALVHEPSVLRKCNVQSM
VTFATCQI-------------------------CTGGQFREFFIKCVTAGNTNAI-----
------------------------------------------------------------
----------------------------------------YYEGLYAALIVGP-EKCIRI
LQPNVPNHDLSTLAVGIFNVCIGNVKEASK-LFQQFEANHY----DLRSDAIVGLGADLE
WRLISFGAPYMNRYGASFK---FPDDEVIKS-PSCL------YGHDYTVDFEGSCKN---
------------CRLFWICCNISHI------------------------L
>gi|15242841|ref|NP_198331.1|	   219 residues, 50 /line  unknown protein [Arabidopsis thaliana]
--------------------------------------------MEIEMPDIPDDLLAKI
VKLVADDRWWLLGPI--------------------LKAGRRGRDMVYKDDVLKDACIYSL
CSDPSDLY-----------------------------YFRPFFERCLKAGNKTAI-----
------------------------------------------------------------
----------------------------------------YYEGLRVVAEGCDLNGGLEL
LAQLVPEDGASTIACGIFSMCLGNEAMAVH-YLEQFGIFHA----PLGTQRVRLWGEELV
RDLRPYRRISHASYRKAFI---YPLCKGIPS-SDCAM-----DCALASSGYENFCND---
------------CYLWWLSGKVCQM------------------------V
>gi|7523396|emb|CAB86454.1|	   216 residues, 50 /line  putative protein [Arabidopsis thaliana]
--------------------------------------------MGIEMPDIPDDILAKI
VKLVADDRWWLLGPI--------------------LKAGRRGRDLVYRDDVLKDACIYSL
CSDPSDLFTFR-NRE--------------TGI-VMQGRYRPFFERCLKAGNKIVI-----
------------------------------------------------------------
----------------------------------------YYEGLRVVAEE---------
-------DGAATIACGIFSMCVGNEEMAVH-FLEQFGIFHA----PLGTERVRVWGEELV
RELRPYRRITHTAYRKSFI---YPMCKGILS-PDCAK-----DCAVASAGYENFCND---
------------CYLWWLSRKVCQM------------------------I
>gi|15225145|ref|NP_178696.1|	   231 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------------------------------------------MVNPTIPDDLLAKI
AKKMTDKCWWDLQPL--------------------LRSDTRGGDIVYRLDVLKGANIFSM
CDDPDDYQVDGSHHP--------------SGP-QGEGRHRAFFKRCVDAGNPTAT-----
------------------------------------------------------------
----------------------------------------YFEALRVLTHERDIKGAINL
LRPHVPSQAHATLACAILFIIDGNDYMGAM-FLNLFERNHY----PFRTKEIRDLCEEFL
EDLKKFRPPYNNTYGSTFS---YHNSHGIQT-PDCAL-----LCYIVSGPFKNVCNS---
------------CYLWWCARRVSQM------------------------L
>gi|22327138|ref|NP_680237.1|	   231 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------------------------------------------MVNPTIPDDLLAKI
AKTVAHKCWWDLQPL--------------------LRSGRRGRDVVYRPDVLKGANIFSM
CEDPDDYQVDGSHHP--------------SGP-QEEGRHRAFFKRCVDAGNPTAM-----
------------------------------------------------------------
----------------------------------------YFEALRVLTHERDIKGAINL
LRPHVPSQAHATFACAILYIIDGNDYMGAI-FLNLFGRNHY----PLGTEETRDLCEEFL
EDLKKFRPPYNNTYGSTFS---YPNSRGIKT-PDCAL-----LCYIVSGPFKNVCNC---
------------CYLWWCARRVSQM------------------------L
>gi|11994701|dbj|BAB02939.1|	   191 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
----------------------------------------------MVNPTLPDDLLSKI
AKNLADQCCW--------------------------------------------------
----------RGHNP--------------SGS-ADEGRHRTFFLRCFAANNPTAV-----
------------------------------------------------------------
----------------------------------------YYEGIRVLTHERNINGAIRL
LQRHAPVRANATLACAIVFICAGYDYMGGL-FLQLFTRNHY----PLDSVATRVLGDEFI
EEIKKFDPPYSNTYGPTFS---YPTSHGISM-PPCAL-----YCYMVSGAFQNVCNR---
------------CYLWSCARRVSQM------------------------L
>gi|15239426|ref|NP_198501.1|	   231 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------------------------------------------MVNPTLPDDLLSKI
AKNLADQCWSDLRPL--------------------VRAGTRGRDIVYRPDVLKDANILTL
CDSPDDFQAGGGHNP--------------SGS-ADEGRHRTFFLRCFAANNPTAV-----
------------------------------------------------------------
----------------------------------------YYEGIRVLTHERNINGAIRL
LQRHAPVRANATLACAIVFICAGYDYMGGL-FLQLFTRNHY----PLDSVATRVLGDEFI
EEIKKFDPPYSNTYGPTFS---YPTSHGISM-PPCAL-----YCYMVSGAFQNVCNR---
------------CYLWSCARRVSQM------------------------L
>gi|42570701|ref|NP_973424.1|	   264 residues, 50 /line  unknown protein [Arabidopsis thaliana]
MTFISTVIAPTKFTV-------------VVIKVKKLLTISDYLISNMVNPTLPDDLLSKI
AKNLADQCWSDLGPL--------------------VRSGTRGRDIVYRPDVLKDVNILTL
CNSPDDFQAGGGHNP--------------SGS-ADEGRHRPFFLRCFAANNPTTV-----
------------------------------------------------------------
----------------------------------------YYEGIRVLTHERNINGAIRL
LQRHAPVRANATLACAIVFICAWYDYMGGL-FLQLFTRNHY----PLDSVATRVLGDEFI
EEIKKFDPPYSNTYGPTFS---YPTSHGISM-PPCAL-----HCYMVSGAFQNVCNR---
------------CYLSSCARRVSQM------------------------L
>gi|15226702|ref|NP_179213.1|	   141 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------------------------------------------MVNPTISDDLFAMI
AKKVADKSWLDLKPL--------------------IRSGTRGRDIVYRPDVLKDANIYSL
CRVPDDFQVGGGHNP--------------TGP-QGEGRNRPFFKRCLLANNPTAV-----
------------------------------------------------------------
----------------------------------------YNEAIRVLIHETDINGALKL
MQRHAPVRADATIVCAIIFICAGYEWN---------------------------------
------------------------------------------------------------
--------------------------------------------------
>gi|4262217|gb|AAD14511.1|	   193 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
----------------------------------------------MVNPTISDDLLVKI
AKKVADKCWLDLKPL--------------------LRSGTRGRDIVYRPDILKDANIFSL
CGVPDHFQVGGGHNP--------------TGP-QGESRNRPFFKRCLLANNPMAV-----
------------------------------------------------------------
----------------------------------------YNEAIRVLIHESDINGAFKL
MQRHAPVRADATIACAIIFICAGYDYMGGL-FLQLYTRNHH----PLD------------
--------------------------HGIKM-PPCAY-----HCYMVSGAFKNVCNK---
------------CHLWSCARRVS---------------------------
>gi|22325631|ref|NP_027957.1|	   231 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------------------------------------------MVNPTISDDLLTMI
AKKVADKSWLDLKPL--------------------IRSGTRGRDIVYRPDVLKDANIYSL
CRVPDDFQVGGGHNP--------------TGP-QGEGRNRLFFKRCLLANNPTAV-----
------------------------------------------------------------
----------------------------------------YNEAIHVLIHETDINGALKL
MQRHAPVRADATIACAIIFICAGYDYMGGL-FLDLYTRNHH----PLDSDFTRDLCEEFF
EEINKFNPPYNNTYARSFC---YPSSHGIKM-PQCAY-----HCFMVSGAYQNVCNK---
------------CYLWSCARRISRI------------------------L
>gi|4581178|gb|AAD24661.1|	   121 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
----------------------------------------------MVNPTISDDLLAMI
AKKVADKSWLDLKPL--------------------IRSGTCGRDIVYRPDVLKDANIYSL
CRVPDDFQVGGGHNP--------------TGP-QGEGRNRPFFKRCLLANNSTTV-----
------------------------------------------------------------
----------------------------------------YNEAIRVLIHETDINGALKL
IQRHAPV-----------------------------------------------------
------------------------------------------------------------
--------------------------------------------------
>gi|15229117|ref|NP_189845.1|	   230 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------------------------------------------MVNSTISDDLLAKI
AKKMADNCWLDLKPL--------------------LRSGTRGRDIVYRPDVLKDANIFSL
CGVPDDFQLGGGHYP--------------SGP-QLEG-NRPFFKRCLLANNPTTV-----
------------------------------------------------------------
----------------------------------------YNESLRVLIHKSDINGAIKL
MQRHAPVRADATIACAIIFICSRYDYMAGL-FLQLYTRNHH----PLDSDITRDLCEGFL
EEIKKFNPPYNNTYGYSFC---YPSSHGIKM-PPCAY-----HCYMVSGAFKNVCNK---
------------CYLWPCARRVSQM------------------------L
>gi|15225697|ref|NP_178741.1|	   263 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------------------------------------------------MPAELLAKI
VSLVSENGVEDLKSW--------------------IRSGHAGKDVVLSKETLKRVGL---
--DKSDLSAYMEFIDGRLCMEDPFIGELVTNP-PLKRAGRPKCPICKKNGHMCPETS---
-VRPRVVTMG--KKKRMGNIVDINQDVLDKIVSIIARDRVDVLKSWMNTRRAGKKAVYSP
ATLSSVRLDLNEN---------------------------FVQCLKLGFRNLDLDGAISV
LNKVQHTYLVAALLLIMLQSCACTLVE---------------------------------
--------------KNYWK---FRDKFNVRRI-----------NVSYKHNRSQTIRK---
------------LLLHMAFRGFSTL---------------------LVFP
>gi|15217716|ref|NP_174100.1|	   120 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MWT
FTKTYTTTYTATLACAILYICAGNAHMGGV-YLRLFGSNHY----ALESEDARDICEEVL
EDIKKYGNTLKYTYANSFS---FPECVDVST-PECAE-----VCYIRSRLFNNLCNQ---
------------CYIWLCAKQISQI------------------------L
>gi|6693027|gb|AAF24953.1|AC012375_16	   159 residues, 50 /line  T22C5.25 [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MWT
FTKTYTTTYTATLACAILYICAGNAHMGGV-YLRLFGSNHY----ALESEDARDICEEVL
EDIKKYGNTLKYTYANSFS---FPECVDVST-PECAE-----VCYIRSRLFNNLCNQLNA
LTPNIALYMKPYCSTYMPYKQTSTQPSVRERNEYFVDVHGAIMRGTQEFV
>gi|15229146|ref|NP_189860.1|	   230 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------------------------------------------MPNPNIPDDLLAKI
AKKIADKCWWYLRPM--------------------LKSGPRERDIVYRPNVLKDANIFSM
CDDVDDFYAAG-HDP--------------NDI-NSEGRYRPFFKRCLEAGNPTTI-----
------------------------------------------------------------
----------------------------------------YHEGLRLLTHESDIQGAILH
LERIAPRNAATTLACAILYICAGNAHMGGV-YLRLFGSNHY----ALESEEARDICEEVL
EDIKKYGNTLKYTYANSFS---FPECGDVRT-LECAE-----MCYMRSRLFNNLCNQ---
------------CYIWWCAKRISQI------------------------L
>gi|42570771|ref|NP_973459.1|	   230 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------------------------------------------MTNPNIPDDLLAKI
AKKMAEKCWWYLGPM--------------------LKSGPRGRDIVYRPDVLKDANIFSM
CDDPDDFYAAG-HDP--------------NDI-NSEGRYRPFFKRCLQAGNPTAI-----
------------------------------------------------------------
----------------------------------------YHEGLRLVTHESDIQGAILH
LERIAPRNAAATLACAILYICAGNAHMGGV-YLRLFGSNHY----ALESEEARDICEEVL
EDIKKYGNTLKYTYANSFS---YPECGDVST-PECAD-----VCYIRSRLFNNLCNQ---
------------CYIWLCAKRISQI------------------------L
>gi|42573513|ref|NP_974853.1|	   230 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------------------------------------------MPNPNIPDDLLAKI
AKKMADKCWWYLGPM--------------------LKFGPRGRDIVYRPDVLKNANIFSM
CDDPDDLYAAG-HDP--------------NDI-NSESRYRPFFKRCLEVGNPTAI-----
------------------------------------------------------------
----------------------------------------YHEGLRLVTHESDIQGAILH
LERIAPRNAAAILACAILYICAGNAHMGCV-YFRLFGSNHY----ALESEEAREICEEVL
EDIKKYGNTLKYTYANSFS---FSECGDVSS-PECAE-----MCYMRSRLFNNLCNQ---
------------YYIWWCAKRISQI------------------------L
>gi|8953703|dbj|BAA98061.1|	   230 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
----------------------------------------------MTNPNIPDDLLAKI
AKKMADKCWWYLGPM--------------------LKSGPRGRDIVYCPDVLKNANIFSM
CDDPDDFYAAG-HDP--------------NDI-NSEGRYRPFFKRCLQAGNPTAI-----
------------------------------------------------------------
----------------------------------------YHEGLRLVTHESDIQGAILH
LERIAPRNAAATLACAILYICAGNAHMGGV-YLRLFGSNHY----ALESEDARDICEEVL
EDIKKYGNTLKYTYANSFS---FPECVDVST-PECAE-----VCYIRSRLFNNLCNQ---
------------CYIWLCAKRISQI------------------------L
>gi|15238349|ref|NP_198351.1|	   230 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------------------------------------------MPNPNIPDDLLARI
AKKMADKCWWYLGPM--------------------LKSGPRGRDIVYRPDVLKDANIFSM
CDDPDDFYAAG-HDP--------------NDI-NSEDHYRPFFKRCLQAGNRTTI-----
------------------------------------------------------------
----------------------------------------YHEGLRLVTHESDIQGAILH
LERIAPRNAAATFTCAILYICAGNAHMGGV-YLRLFGSNHY----ALESEEARDICEEVL
EDIKKYGNTLKYTYANGFS---YPECGDVST-PKCAE-----MCYMRSRLFNNLCNQ---
------------CYIWLCAKRISQI------------------------L
>gi|15230105|ref|NP_189081.1|	   230 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------------------------------------------MTNPNIPDDLLAKI
AKKMADKCWWYLGPM--------------------LKSGPRGRDIVYRPDVLKNANIFSM
CDDPDDFYAAG-HDP--------------NDI-NSEDRYRSFFQRCLQAGNPTAI-----
------------------------------------------------------------
----------------------------------------YHEGLRLVTHESDIQGAILH
LERIAPRNAAATLACAILYICAGNAHMGGV-YLRLFGSNHY----ALESEDARDICEEVL
KDIKKYGNTLKYTYANSFS---FPECVDVST-PECAE-----VCYIRSRLFNNLCNQ---
------------CYIWLCAKRISQI------------------------L
>gi|61742727|gb|AAX55184.1|	   230 residues, 50 /line  hypothetical protein At4g07943 [Arabidopsis thaliana]
----------------------------------------------MPNPNIPDDWLAKI
AKKMADKCWWYLRPM--------------------LKSGPHGRNIVYRPDVLKDANIFSM
CDDPDDFYAAG-HDP--------------NDI-NSECRYRPFFKRCLEAGNLTAI-----
------------------------------------------------------------
----------------------------------------YHEGLRLVTHESDIKAAILH
LERIVPRYAAATLACAILYICAGNAHMGGV-YFRLFGSNHY----ALESEDTRDICEEVL
EEIKKYGNTLKYTYAKSFS---YPECGDIRT-PDCAM-----MCYMRSGLFNNLCNE---
------------CYIWWCAKRISQI------------------------L
>gi|15225563|ref|NP_179018.1|	   161 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
-----------MIAR--------------------VEMR---------------------
--------QYR-QNL--------------VLM-RVGGLFRKQFENALEANNPEAH-----
------------------------------------------------------------
----------------------------------------YLEGLRYACWEKDLDMAEKH
IFKAINKVDEALFVMAMLTICGGEKELGDF-FPEQLF--------AQSWGEVLAMGDSLF
AALERMAVRQGTTYMLTWN-GAHPPYVSIHN-------------------LYNRCEE---
------------YYIFFCSKEFCRC------------------------C
>gi|15241611|ref|NP_199301.1|	   161 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
-----------MLAR--------------------VEMR---------------------
--------QYR-QNP--------------VLM-RVGGLFRKQFDDALEANNPEAH-----
------------------------------------------------------------
----------------------------------------YLEGLRYACWEKDLVMAKKH
IFKAVNKVDEALFVMAMLSICGGEKELGEF-FTEQLF--------ALPWAEVLAMGDSLF
SALERMAVRHGTAYKLTWN-GAHPPCVSIHN-------------------IYNRCEE---
------------CYIFFCSKEFCRR------------------------C
>gi|8778376|gb|AAF79384.1|AC007887_43	   176 residues, 50 /line  F15O4.14 [Arabidopsis thaliana]
----------------------------------------------------------MV
FTSLCLGCSSRLGGR--------------------LKGG---------------------
--------FGQ-TNP--------------VLM-RVDGLFRKQFDDTLEANNPEAH-----
------------------------------------------------------------
----------------------------------------YLERLRY-----DLVMAKKH
IFKAVNKVDEALFVMAMLSICGGEKELGEF-FTEQLF--------ALPSAKN-------H
SPLNTLRVVDCKMMRLFRN-SLQIDCMMVMVMAIEYQ-----ILMMRSSMVMEWGSS---
------------RTSKGCERPLNFR------------------------A
>gi|15242052|ref|NP_197577.1|	   231 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------------------------------------------MEMMPDLPDDILAKI
VKLVADDRWWLLGPI--------------------LKAGTRGRNIVYRSDVLKDANIYSL
CTDPSDLYSFR-CQT--------------TGV-QMKGRYRDFFERCLNSGNNTAI-----
------------------------------------------------------------
----------------------------------------YYEGLMVVAEERDVKRGIAL
LHQNVPDDGLATFACGVLSICAGDEEMAVH-YLEVFGGKHC----KLGTEEVRRYGEELV
HDLQPYRRHTSFPLRKTFV---YPICKELPS-PDCAM-----DCATVSGPYEILCNE---
------------CYLWWLSRKVSQM------------------------L
>gi|15229118|ref|NP_189846.1|	   219 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------------------------------------------MVNPTISDDLLAKI
AKKIADKCWWDLQPL--------------------LRSGNRGRD------------IFSL
CGDPDDIQARGDHYP--------------SGV-EEEGRHRPFCLRCLAADNPTIV-----
------------------------------------------------------------
----------------------------------------YYEVMRVLTHQRDIQGAINL
LRRHAPAQADATLASGILFIIDGNYYLGVM-FLQLFARHHY----PLGTEETRDSCEQFM
DEIKQYRPTYNNTYGATYA---YPNSHGIQT-PPCAT-----YCYMVSCPFKKNCNC---
------------CYLRWCAKRLSII------------------------L
>gi|12320969|gb|AAG50614.1|AC079605_19	   175 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
---------MQKFT----------------------------------------------
---------------------------------------KISNNETSSASDVK-------
------------------------------------------------------------
-------------MVAAIQEVYLPAPLLAKIVSYVAESGVDSLKSFVKAGPLFKAAVYSK
ETLSCVRLDRSRYFMWWSMPHSIYYHFFTKCLEANNPHALTAVLYKRIAYEN--------
-----------------------------------------LVVECY-------------
--------------RSSLWMEPYGEDGG-WVQIDGAY-----WAQPRVRESIPRCSR---
------------CKSRAHKRSNCPK------------------------Y
>gi|15239281|ref|NP_198455.1|	   165 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
--------------------------------------------MVVRPNPKY-------
------------------------------------------------------------
-------------LVAAIPEVYLPAPLLAKIVSYVAESGVDSLKSFVKAGPLFKAAVYSK
ETLSCVRLDRSWYFMWWSMPHSIYYHFFTKCLDANNPHALTAVLYKGIAYEN--------
-----------------------------------------LVAECY-------------
--------------RSSLWMEPYGEDGG-WVQIDGAY-----WAQPRVRESIPRCSR---
------------CKSRAHKRSNCPK------------------------Y
>gi|15234215|ref|NP_193664.1|	   118 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
--------------------------------------------MVVRPNPKY-------
------------------------------------------------------------
-------------LDAAIPEVYLPAPLLAKIVSYVAESGVDSLKSFVKAGPLFKAAVYSK
ETLSCVCLDRSRYFMWWSMPHSIYYHFFTKCLEANNPHALTAVLYKEIAYEN--------
-----------------------------------------LVAECY-------------
--------------RSSL------------------------------------------
--------------------------------------------------
>gi|15219470|ref|NP_175109.1|	   130 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------MSEPSSVSGVK-------
------------------------------------------------------------
-------------KVAIMPEIHIPAPVLAKIVSYVAEEGVDALKPFVKAGPLFKSAVYSK
ETLSCVRLDKSRYYMWWSMTHSIYYHFFTKCLEAKNPHALNALFYKPIAYEN--------
-----------------------------------------FAAECH-------------
--------------RATVWAEHYGEYEA--------------------------------
--------------------------------------------------
>gi|15226748|ref|NP_178838.1|	   131 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
-----------------------------------------MSEQPSSVSGVK-------
------------------------------------------------------------
-------------KVAIIPEIHISAPVLAKIVSYVAEESVDALKPFVKAGPLFKSAVYSK
ETLSCVRLDKSRYYMWWSTTHSIYYHFFTKSLEAKNPHALNAVLYKPIAYEN--------
-----------------------------------------FAAECY-------------
--------------RATLWAELYGEYEA--------------------------------
--------------------------------------------------
>gi|15228567|ref|NP_189837.1|	   130 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------MSEPSSVSGVK-------
------------------------------------------------------------
-------------KVAIIPEIHIPAPVLAKIVSYVVEEDVYALKPFVKAGPLFKSALYSK
ETLSCVRVDKSRYYMWWSMTHSIYYHFFTKCLEAKNSHALNAVLYKPIAYEN--------
-----------------------------------------FAAECY-------------
--------------RATLWVELYGEYEA--------------------------------
--------------------------------------------------
>gi|15239277|ref|NP_198453.1|	   128 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
--------------------------------------------MVRDKSGDI-------
------------------------------------------------------------
-------------MVAAFPEIFIPAPILAKIVSYVAEDGVDALKPLVMAGPTFKAAVYSK
ETLICVRIDKSRYFMWWSMPHSIYYHFFTKCLEANNPHALKAIMYKPIAYEN--------
-----------------------------------------FAAKCY-------------
--------------RSTLWAELYGEHEG--------------------------------
--------------------------------------------------
>gi|7529244|emb|CAB86474.1|	   176 residues, 50 /line  putative protein [Arabidopsis thaliana]
---------MGKIVDTYK------------------------------------------
-----KKDMVYILLFFYFLLFCPTNRNLKNRIFPVLTISQVLRRSVFIWRHNV-------
------------------------------------------------------------
-------------KVAVIPEIHISAPVLAKIVSYVAKESVEALKPLVKAGPLFKAAVYSK
ETLSCVRLDNSRYYMWWSTTHSIYYHFFTKRLEAKNPHALNDVLYKPIAYEN--------
-----------------------------------------FAAECY-------------
--------------RATLWAELYGEYGG--------------------------------
--------------------------------------------------
>gi|15228569|ref|NP_189838.1|	   146 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------MRRQK----------------------------------------------
-----------------------------------------RSSEPSAGCSVK-------
------------------------------------------------------------
-------------METTIQEFHMLPLLLAKIVSYLAEDGVDALKNLIKAGPVFKEAVYSE
ETLCCVRLDRSRYFMWWSMPHSIYYHFFNKCLEAKNPHALTAVLYKGIAYEN--------
-----------------------------------------FVEECY-------------
--------------RAPLWVEPYGEDGG-WVQIDGAY-----SA----------------
--------------------------------------------------
>gi|22328309|ref|NP_680580.1|	   128 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------MDALKNLIKAGPVFKEAVYSE
ETLRCVRLDRSRYFMWWSMPHSIYYHFFNKCLQANNPHALTAVLYKGIAYEN--------
-----------------------------------------FVEECY-------------
--------------RAPLWVEPYEEDGG-WVQIDGAY-----WAQPRVRAMNARCCR---
------------CKSAAH--KTCPN------------------------M
>gi|8655998|gb|AAF78271.1|AC020576_15	   119 residues, 50 /line  Contains similarity to a putative protein T32A11.20 gi|7413619 from Arabidopsis thaliana BAC T32A11 gb|AL138653
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------METTIQEFHIPPPLLAKIVNYLAEDGVDALKNLIKAGPVFKEAVYSE
KTLRCVRLDRSRNFMWWSMPHSIYYHFFNKCLQANNPHALTAVLYKGIAYEN--------
-----------------------------------------FVEECY-------------
--------------MAPLWVEPYGEDGG--------------------------------
--------------------------------------------------
>gi|15219466|ref|NP_175107.1|	   266 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------MPKIVCEKGKCIHPRPMS------------------PTRH-----------
-----------------------------------------YWRPPSALAPVR-------
-------------------------------------------------GNQFAVQP---
-LRQPLVHFN---LQRKIARLYIPEPILALIVSHVSEEGIEALKNWIKSGHEGKSAAFSV
ETLSRVRLDKSPDFINMSSPDSVHFSFYSKCLAKRNPYAMYLQSLRLGFCSLDLKGAISL
LNDCKDVIPIAKLLYIALNRCAGNEVLDE---FNTFK----RENKCFT--DVDIMAKTLI
DHISDLEPKRFGSYAELFHYEDYPDCWL-IHEFYNKY-------------NGERCSH---
------------CVYFFLFRDILLL------------------------S
>gi|15219491|ref|NP_174744.1|	   231 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-------------MSTSSKCLHSITQS------------------S--------------
------------------------------------------------------------
------------------------------------------------------------
---------D---TQRKIARLYIPEPILALIVSHVSEEGIEALKNWIKSGHEGKSAAFSV
ETLSRVRLDKSPDFINMSSPDSVHFSFYSKCLAKRNPYAMYLQSLRLGFCSLHMKGAISL
LNDCKDVIPIAKLLYIALNRCAGNEVLDA---FNTFK----RENKCFT--DVDIMAKTLI
DHISDLEPKRFGSYAELFYYEDYPDCWV-IHEFYNEY-------------NGERCSH---
------------CVYFFLFRDILLL------------------------S
>gi|15228561|ref|NP_189834.1|	   138 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-------------MSC--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------KTKPLRYVSPKLKVEFCSLDLIGAISL
LSDCKDVIPIAKLLYIALNRCAGNEVLDA---FNTFK----GENKCFT--DVDIMAKTLI
GHVSDSEPKRFGSYAELFHYEDYPECWL-IHEFYNEY-------------NGGRCSH---
------------CIYFFLFRDILLL------------------------S
>gi|42572825|ref|NP_974509.1|	   261 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-------------MSTSSKCLHSITQS------------------S--------------
------------------------------------------DTQVKFFIFKQ-------
-------------------------------------------------YSLHSFHK---
-VYVTSITFRLRCQQRKIARLYIPEPILALIVSHVSEEGIEALKNWIKSGHEGKSAAFSV
ETLSRVRLDKSPDFINMSSPDSVHFSFFSKCLAKRNPYAMYLQSLRLGFCSLDLIGAISI
LNDCKDVIPIAKLLYIALNRCAGNEVLDA---FNTFK----RENKCFT--DVDIMAKTLI
GHISDSEPKRFGSYAELFHYEDYPDCWL-IHEFYNEY-------------NGERCSH---
------------CIYFFLFRDILLL------------------------S
>gi|42571749|ref|NP_973965.1|	   218 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------MRCQQRKIASLYIPEPILALIVSYVSQEGIEALKNWIKSGHDGKSAAFSV
ETLSRVRLDKSPDFINMSSPDSIHFSFYSKCLAKQNPYAMYLQSLRLGFGSLDLIGAISL
LNDCKEVIPIANLLYIALNRCACNKVLDA---FNTFK----RENKCFP--DVDSMAKTLI
GHISVLEPKQFGSYVELFHYEDYPHCWL-MHEFYKEY-------------NGERCSD---
------------CIYYFLFRDILLL------------------------S
>gi|15226750|ref|NP_178840.1|	   138 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------MPKIVCEKGKCTHPRPMS------------------PTRH-----------
-----------------------------------------YWRPPSALA----------
------------------------------------------------------------
-------------PPPPFPDFNMPDHVAAKIVSLVSEDGVDMLKAWIQSGPDGKAAVFSN
KLM---------------------------------------------------------
------------------------------------------------------------
FHINEVGPRRQWTYKNSWEFKDYGECWL-DHQNFNEY-------------EGQWCNT---
------------CIYYYLSQEIAHI------------------------S
>gi|15228563|ref|NP_189835.1|	   267 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------MSKIVCEKRKCTHPRPMS------------------PTRH-----------
-----------------------------------------YWRPPSALAPVR-------
-------------------------------------------------GNQFVVQR---
-LRQPLVHF--NLQPPPFPDFHMPDHVAAKIVNLVSEDDVDMLKAWIQSGPDGKAAVFSS
ETFSSVRIDKSPFFIHMAEESSSYHMFYTKCLTAKNPYALYLQSLVLAFHMFELQESIAI
LDVIKDVFPHAGLLYIMLHSCARSIPWEF---YIQYK----RRYYKFS--EVDLFADKLM
FHINEVCPRRQGTYKKTWEFEDYGECWS-DHQNLNEY-------------EGQWCNT---
------------SIYYYLSHEIVHI------------------------S
>gi|15234212|ref|NP_193663.1|	   254 residues, 50 /line  unknown protein [Arabidopsis thaliana]
ME-------LTGLNPEFERVFHVAPVA------------------NLGH-----------
-----TKDLIV------------------------QNIERQCFNTVLSIIICL-------
-------------------------------------------------STCFYFSKTCF
SVFKLLLVC--LFNPPPFSDFHMPEHVAAKIVSLVSEDGVDMLKAWIQSGPDGKAAVFSR
ETLSSVRLDKSPLFIHMAHESSSYHMFYTKCLAFKNPYALYLQSLVLAFHMCELQEAIAI
LDGIKDVFPHAGLLYIMLHSCAGSIPWEF---YSMYK----RRYYKFS--EVDLFADKLM
FHINEVGPRRQGTYKNSWEFEDYGEC----------------------------------
--------------------------------------------------
>gi|15242006|ref|NP_198251.1|	   213 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------MKNSRLYIPEPILALIVSYVSEQGIDALKNWIKAGQVGKLAAFSD
ETLTRVRLDKSPHFIYMSSSNSLYFSFYSNCLEKRNPYALYLHSLSLGFRCLDLCGAISI
LSTCKDRFPLAKLLNIALNRSAGIEVIDD---FNSFN----RENKCFF--DVSLMANKLI
GHISASEPKCFGSYAETFLYEEYPDCWL-IHELNNEF-------------NGERCSQ---
------------CLYFYLFRDILLL------------------------S
>gi|15217476|ref|NP_174984.1|	   154 residues, 50 /line  zinc knuckle (CCHC-type) family protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------MDIHIPQLLMEIIVSKVAEDGVDALKNWLLAGREGKDAVMST
KTVPSVRIDMDNHFMWWSMPHSKYYNFFQKCLAANNPYAKFVEKNKGLTYES--------
-----------------------------------------TTGYYQ-------------
--------------MRCRWNVTHDK--PVFIDMNIEKRCIMHPPFQPGRMVRRTCPR---
------------CKKVGHMCKRCL-------------------------A
>gi|30693454|ref|NP_849756.1|	   154 residues, 50 /line  nucleic acid binding / zinc ion binding [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------MDVHIPQLLIEIIVSKLAEDGVEALKNWLLAGREGKDVLMST
KTLASVCIDMDNHFMWWSMPHSKYYSFFQKCLGANNPYAKFVEKNKGLAYES--------
-----------------------------------------TTGYYQ-------------
--------------MRCRWNVTHDK--PVFIDMNNEKRCIMHPPFQPGRMVRRTCHR---
------------CKKVGHRCKKCL-------------------------T
>gi|15228548|ref|NP_189831.1|	   253 residues, 50 /line  zinc knuckle (CCHC-type) family protein [Arabidopsis thaliana]
MHRSVSTNNPNRYICSRRQQT-PRRMAEQTCSQNLESIVGFKKKGPSTNFHMPAGILAKI
VSYIAEGEIGELKNW--------------------IISGREGMVAVSSPDSQK-------
------------------------------------------------------------
-------------SVISMTEFHIPPPLMEIIVSKVGEDVVDALKNFLLAGREGRDAVLSK
KTLASVRIDKNHHFMWWSMPHSKYYTFFKKCLDANNLYAKFVDNHKGLAYES--------
-----------------------------------------TIGYFQ-------------
--------------MRCRWKVCHGKRNGGLLDLNEMKVCVVQPPYQPNRVGRPRCRR---
------------CKKVGHMLSTCT-------------------------E
>gi|18412969|ref|NP_567305.1|	   116 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------MDIHISQPLMEIIVRKVAEDGVDDLKNWLLAGREGKDAVMSR
KTLAFVRIDMDNHFMWWSMPHSKYYSFFQKCLAANNPYAKFVEKNKGLAYES--------
-----------------------------------------TTGYYQ-------------
--------------MRCRWNVL--------------------------------------
------------------TTNACSL------------------------T
>gi|22328376|ref|NP_680606.1|	   111 residues, 50 /line  zinc knuckle (CCHC-type) family protein [Arabidopsis thaliana]
-------------MCG----------VEESCGESK-------------------------
-----------------------------------------------GSNVVM-------
------------------------------------------------------------
-------------EVISMSEFHIPQPLMEIIVSKVGEDGVDALKNFLLTGREGRVAVC--
------------------------------------------------------------
------------------------------------------------------------
----------------------NGKRNGGFLDLNEIKVCMVQPPYQPDRVGRPRYRR---
------------CKKIGHMLSTCT-------------------------E

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.