FANDOM


>gi|15226716|ref|NP_178834.1|	   169 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
-----------------------------MTSPLH---------------NTTRPPG---
-----------RVVTFTASIHH--------------------STTWSSTTIIIHSTNHST
NRSSITIIIHSTNHSTNKCSITIIIHSTNH---STTKSSSTIIHHSTSYSTASLRVFSIP
HSTRQS---------------------------------SIRKKRRLQQITRP-------
---------------------------ITGPP----------RSSIVLNPSQYCVVLS--
---IRVSEH-----FAISSLYFIFSRKK--------------------------------
-----------------------------------------FSS-ADTVCY---------
-----------------
>gi|116830063|gb|ABK27989.1|	   108 residues, 50 /line  unknown [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------MRSSVFTSIIRQPLDLLTLPRGRVSPPHHSTAYSMTSFRAFFIL
HSTRHS---------------------------------STMKKRRLQLFTRP-------
---------------------------ITRPC----------GSSTVLNPSKYFVVLG--
---IRVSGY-----LAISSMYFSFSKGRS-------------------------------
--------------------------------F----------------G----------
-----------------
>gi|42571747|ref|NP_973964.1|	   150 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------------------------------------------------MIMTN----
-------------------H----------------------------------------
----------STTRSSR-RHHH--------------------FTSPLDPEVECHHLHHQT
--------LTRSLHSTMRSSVFTSIIRQPLDLLTLPRGRVSPPHHSTAYSMTSFRAFFIL
HSTRHS---------------------------------STRKKRRLQLFTRP-------
---------------------------ITRPR----------GSSTVLNPSKYFVVLG--
---NRISGY-----LAISSMYFSFLKGRS-------------------------------
--------------------------------F---------------------------
-----------------
>gi|15230833|ref|NP_189692.1|	   206 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----MFRIVLH--ACCI----FALISG----------DLELLTSYLQEADLITTN----
-------------------HSTKR-----------------------------------S
SRSFRISRDHSTHRSSR-GHHH--------------------FTSPLDHEIECPHLHHQT
--------ITRSLHSTMRSSAFTFTARPLLDLVTQPRGRVSPSQHLTAYSMTSFRAFFIP
HSTRHS---------------------------------STRKKRRLQIFTRP-------
---------------------------LTRPP----------GSSTVLNPSKYFVVLS--
---IRVSGY-----LAISSMYSSFSQTRS-------------------------------
--------------------------------FLP-----SFIS-ADLVF----------
-----------------
>gi|15230834|ref|NP_189693.1|	   206 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----MFRIVLH--ACCI----FALISS----------DLELLTSYLEEADLITTN----
-------------------HSTKR-----------------------------------S
SRSFRISRDHSTHRSSR-GHHH--------------------FTSPLDHEVECPHLHHQT
--------ITRSLHSTMRSSAFTFTARPLLDLVTQPRGRVSPSQHLTAYSMTSFRAFFIP
HSTRHS---------------------------------STRKKRRLQLFTRP-------
---------------------------LTRPP----------GSSTVLNPSKYFVVLS--
---IRVSGY-----FAISSMYFSFSQTRS-------------------------------
--------------------------------FLP-----SFIS-ADLVF----------
-----------------
>gi|22327209|ref|NP_680270.1|	   258 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----MFRIVLH--ACCI----FALISG----------DLELLTSYLEEADLIMTN----
-------------------HSTQR-----------------------------------S
SRSFKISRDHSTTRSRR-GHHH--------------------FTSPLDPEVECPRLHHQT
--------NTRSRHSTSRSSAFTFTARPLLDLITLPRGRVSPSHHSTAYSMTSFRAFFIP
HSTRHS---------------------------------STRKKRRLQLFTRP-------
---------------------------LTRPP----------GSSTVLNPSQYFVVLS--
---IRVSGY-----LAISSMYFSFSQEEV---S--YLVLFPQTLCSR-------LF----
------------------VIRISLYLFSIQFLYLI-----SFTV-VHSVII-L--LLHCC
-YHVFNLFNVYAFCYDV
>gi|42573503|ref|NP_974848.1|	   256 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----MFRIVLH--ACCI----FALISG----------DLELLTSHLEEADLITTN----
-------------------HSTKR-----------------------------------S
SRSFKIPRDQSTPRSSI-GHHH--------------------FTSPLDLFTPPGSRVSSN
--------TTRSPHSTPRSSAFTFTARPLLDLITLPRGRVPPSHRSTAYSMTSFRAFFIP
HSTRHS---------------------------------STRKKRRLQLFTRP-------
---------------------------LTRPP----------GSSTVLNPSKYFVVLS--
---IRVSGY-----LAISSMYFSFSQTRS---F--YLVLFPQTLCSR-------LF----
------------------VIRISLYLFSIQLWFLIFVYCCSFCY--HTTVT-L--LLSC-
------LQPVQRLCFLL
>gi|123469386|ref|XP_001317905.1|	   117 residues, 50 /line  hypothetical protein TVAG_005250 [Trichomonas vaginalis G3]
------------------------------------------------------------
----------------------------------------------------MTPF----
--------------TTA-VTTPFTTAAITPFITVFQTAGETP------------------
------------------------------------------------YLTPFSTAFETP
HSTPFTT-AELTPYGTAA----YTAKETPFETAAITPNVTPIK-----------------
------------------------------------------------TPNPDCVMDQ--
---DKIDNR-----LKYKRIKVIFALGQVVNNN---------------------------
------------------------------------------------------------
----------------I
>gi|123227308|ref|XP_001285974.1|	   171 residues, 50 /line  hypothetical protein TVAG_341870 [Trichomonas vaginalis G3]
------------------------------------------------------------
------------------------------------------------------------
------------------------TPHSTPHSTPHSTPHSTP------------------
--------------------------------------------HSTPHSTPHST-----
--------PHSIPMTTPH----MSQRYQPI------------------------KIEDTD
------------SLSQINE-----------EKLSIEKKSNA--VIYAAVAIGCFLLL---
--------------TLTIVLTLYYTKRHVRNAGTASSSISVQDIQEGTVINPEI------
-------------------DGEDDDLLSKVPL-----WTKT---IENPGPFIT--EFEED
E-VGYF-FMIAANAFNN
>gi|123499253|ref|XP_001327579.1|	   212 residues, 50 /line  hypothetical protein TVAG_224320 [Trichomonas vaginalis G3]
------------------------------------------------------------
--------------------------------------------------MHETPI----
--------------DTM-HETPIDTMHETPIDTIHETPIDTIHE-----------TPIDT
--------IHETP----KITISETIAQT-------------------KIETISET-----
--------PIETVYETIS----NTLIETPIAEGIHPFSST------STSSKNPSSTIQSG
------------AENAS----------------SVKSTKNKS-LIWIIVGISLGILLL--
---------------VTIFIIFVLVHKKTSNPEFSESTNEVEDIPEETVIPREV------
----------------------ITDVTIDNPI-----FTTTMDDCEHSDPFNM--DFQES
T-IEEL---------FL
>gi|123403271|ref|XP_001302207.1|	   171 residues, 50 /line  hypothetical protein TVAG_222310 [Trichomonas vaginalis G3]
--METPMNTAVE----------------------------------TVAMTPVVTA----
-----------------------------------AETAFETPFSTADKTAQETPFS--T
AVETPALTESSTPFNTQ-YQTVFETAFKTPYETVSSTQQETAFETPYETVSS---TQHET
--------VVETP----FETAVETPYETVS-------------------STQQETAFETP
YETVSST-QHETVVETPF----ETAVETPYETVFETAFETPY---ETVSYT---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------
>gi|42573505|ref|NP_974849.1|	   123 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-------------------------------------------------MDLIISI----
-----------------------------------YSTLSTRSHLR----------S--Q
SLDRNTLVHHSTPWSSR-RHHH--------------------FSPPLDTLVEYHHLYHST
--------FTRSP---PLDYIVEYHHHPPLD------------------IILDCQLQSLL
HSALNQTLEHKEEKKTP------AYHSTNHSTTWV------------ECRS---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------
>gi|123426487|ref|XP_001307047.1|	   242 residues, 50 /line  hypothetical protein TVAG_233680 [Trichomonas vaginalis G3]
--MPTPFETVYE----------------------------------TIR-----------
------------------------------------------------YTDMETPY----
--------------ETI-PMTPFVTFDVTPYSTL----EYTSKETPIATIHM---SPFKT
--------FVETP----YDTLSITPLLTP-------------------------------
----VET-IPMTPKKSPI----STSEYTPFITPDKSPIQTPA---RTIKIEDGQSIVETR
---------------NSDN--------ANSE--SAEKSSQKK-YTFMFVGIACFF-LL--
--------------VVIGIVCFALYMRHKNNVE--YDSETPEVE-PHEIDEFKLVM----
------------------IQKFNIYLFFILLI-----YELKVVY-VEGFCDFF--CKRKN
SYIFER--FCIIFFY-I
>gi|123976401|ref|XP_001330521.1|	   201 residues, 50 /line  hypothetical protein TVAG_383700 [Trichomonas vaginalis G3]
--MGT-------------------------------------------------------
----------------------------------------------AEYTKIETPF----
--------------ETN-LNTPELTVHETPF--------ETNLNTPELTVHE---TPFET
--------NLNTP----ELTVLETPFATKS------------------------------
----IET-TKEIPYLSPV----YTPLTAPSHESNLIDTKIEI---TNTDSSEPSSPIISE
------------KSNRTYV--------ENGE--NAKSTKGKS-SILIIVIVSLILALI--
--------------IITAIILYVICRKKEETAE--TESSMTDEM-EETVISTQVNT----
------------------NEE-------------------------FATYDC--------
-YIRKR-----------
>gi|123428456|ref|XP_001307503.1|	   213 residues, 50 /line  early transcribed membrane protein, putative [Trichomonas vaginalis G3]
---MSMF-----------------------------------------------------
------------------------------------------------ETPFSTAF----
--------------ETN-HKTPFISMFETPYNTAFQTAFETAFETPFI-----------T
--------AKETE----EIQDIPIPIPEPE------------------------------
---------------KSS----SSVSSSDYNESSSSSLSQDL---SSSQSSSSSNIKSSG
---------------NLGQ--------DDADAINKEKIKKKKTIVYSIIGAILAL-II--
--------------IITIIVL-SIYFYSRKSDE--KESTVEEEMIEETVISS--------
-------------------TGETAGVTIDNPL-----WTTTVVD-DSEDIFRH--DFEEQ
S-MTIN--IFE-----A
>gi|123337223|ref|XP_001294321.1|	   162 residues, 50 /line  hypothetical protein TVAG_318700 [Trichomonas vaginalis G3]
------------------------------------------------------------
-----------------------------MH-----------------------------
------STPHSTPDSTMHSTPH--------------------STPHSTPDSTMHSTPHST
--------PDSTMHSTP--------HST-------PDSTMHSTPHSTPDSTMHSTPHSTP
HSTPHST-PHSTPHSTPA----STPHST--------PHSTPASTPASTPATTP-------
---------------------------ADTPAITENEAAQAFGSTTFIVPMTIVLIVT--
---I----------------SLIV-VFA--------------------------------
-----------------------------------------LIA-NQSCWR-W-------
-----------------
>gi|161970|gb|AAA03000.1|	   257 residues, 50 /line  chagas antigen
EFGPTISHVTVN--NVLL----YNRQLN----------AEEIKTLFLSQ-DLIGTE----
-------------------AHMDSSSDSSAH---G---------------TPSTPVD---
------STAHGTPSTPADSSAH--------------------STPSTPADSSAHSTPSTP
--------VDSSAHSTPSTPADSSAHST-------PSTPADSSAHSTPSTPVDSTAHGTP
STPADSS-AHSTPSTPVD----SSAHSTPSTPADSSAHSTPSTPVDSSAHSTPSTPADSS
------------AHGTP----------STPVDSSAHSTPSTPAD-SSANGTVLILPDG--
---AALSTFSG---GGLLLCACAL-LLH--------------------------------
-----------------------------------------VFF-TAVFF----------
-----------------
>gi|42570721|ref|NP_973434.1|	   158 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
--------------------------------MLH---------------DLNRPLD---
-----------PLVEY-HHESH--------------------SITSLDHLVEYHHLHHLT
--------ITRSHHLTTRSSIFITVTRSLY-----HQVEYHHLHHSTSYSVASFRVFSIP
HSTRHL---------------------------------STRKKRRLQLITRS-------
---------------------------FTRPS----------GSSTVFNPSQYCVVLS--
---IRVSEN-----FAISSMYFTFSMKE--------------------------------
-----------------------------------------FYS-VDTVFL-T--FL---
-----------------
>gi|9279787|dbj|BAB01208.1|	   134 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
----------------MD----IQKRPK----------Y----------------D----
-------------------SNKKKFLMVLGISRFH---------------HITRPPG---
-----------RVSSPPPPDHH--------------------SITPLDPEVEYLHLHYQI
--------TTRSSHSTKKSSISITTTR-------------------------------LP
TRWRA----------------------------------SESSPFRTQPDTRA-------
---------------------------QGRKE----------DSSYSLDLS---------
---LDHRGRVQ---FLIRPNTASF------------------------------------
------------------------------------------------------------
-----------------
>gi|29648986|gb|AAO86835.1|	   108 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
-----------------------------------------------------MVE----
-------------------Y----------------------------------------
-----------------HLDNH--------------------SITLXDPLVEYHHVHHIT
--------FTRSHYSTTWSSTFITFTRSLY-----HQAEYHHPYHSTTYSTASXRVFSIL
HSTRHS---------------------------------SRRKKRRLQLITRP-------
---------------------------LTRPP----------GSSAVLNPS---------
------------------------------------------------------------
------------------------------------------------------------
-----------------
>gi|4773910|gb|AAD29780.1|AF147259_3	   267 residues, 50 /line  F10A2.13 gene product [Arabidopsis thaliana]
-----MANVSKHLGSSCIRIACFGVFSGVEGAKKDFTRSIHSIQAATEEASIHSTSLLDP
GCYRGGYSLLDPLTRSRQPQMKQQIDLLAPPTRSIYSTTAVDELIGRSGPDRIKPLDPLS
STCFTTSTNHSTPSSSR-RPRH--------------------FAPPLDHMAEYHQLHHLT
--------ITRSHHSTPWSSTSITFTRSLTRLHGRPSITISITRIYTRLPALESSPF---
---------------------------------------------RTQPNTRA-------
---------------------------QGRKE----------DSSSSLDHSLDHLVEFEP
RHFRAQKVFDEMSEPLIPEIRGSVPRLT--------------------------------
-----------------------------------------LVN-G----------D---
-----------------
>gi|118716436|ref|ZP_01568973.1|	   264 residues, 50 /line  hypothetical protein BmulDRAFT_5259 [Burkholderia multivorans ATCC 17616]
--------MRNAS---------LMVRPL---------------------RKSGPPH---G
PPHG-PQGTPQGTPQG-----P-------------HGTPHGSPHGP-QGTPQGTPQGP--
-HGTPHGSPQG-PHGTP-QGPPHG-----PHGTPQGPPQGAPH-----------------
-----------GP----HGTPHGPPQGT-------------------PHGSPQ-------
-GPPHGT-HKQKCSSVCALALH---------RGNKERLLPDQ---LLPLQEKDMTPIDIA
TLTKVER-----------------------------------------------------
------------------SIL-LYAETCCVDAGGLLEGERMNAD-DMT----ALRKFADA
GILSFGRIPYHLLASLSGLRQPTHWITLTDDA-----WQLAHALRRQRAARGSASRRKVD
E-VLAE-------REVT
>gi|126343124|ref|XP_001369413.1|	   210 residues, 50 /line  PREDICTED: similar to Endoglucanase precursor (Endo-1,4-beta-glucanase) (Spore germination protein 270-6) (Cellulase) [Monodelphis domestica]
MPQETPQEKAQET---------PQETAR--------------------ETPQETPQ---E
TARETVQETAQETARETAQDIA-------------QEMPQETPQETAQETPQETPQEIA-
-QEKPQEIPQEMPQETA-QETTPETVQETPQETAQETAQETAQET-----------PQET
--------AQETP----QETAQETPPET-------------------AQETPQER----A
QETAQET-ARETPQETAQETARETAREMPQETAQETPQETAQ---ETPPETAQETPQETA
QETARET-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------A
>gi|123431663|ref|XP_001308257.1|	   258 residues, 50 /line  conserved hypothetical protein [Trichomonas vaginalis G3]
----------------------MIIIAP--------------------E-----------
------------------------------------------------------------
-------TAFETPFLTS-FETPYETASSTPFETAFQTAAQTAFET-----------PFVT
--------AFETA----YQTAFKTPFDT-------------------AGQT--------M
SETPFES-AFETPFVTAF----ETAFQTPEITQNNVPPIDPQ---PSENEGDPDKPTEKP
SENEQGKQSEKNSANAPFHSVSSSTNSGKIQEQQTTETASKS-KSWIYILIGVVCVLA--
--------------LIAIIVV-VVVLKKKSDNSDSLETEPADDN-PETVIGEDEFAAEGN
TTDVFNL---------------------------------TSSICGDNDPFNVGSDLESD
S-VNEN-------YVFI

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.