FANDOM


>gi|42570739|ref|NP_973443.1|	   208 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------MG
KRINPLPPQYNF--TPADNNPPPQSSQERVRVQPQQARSFTP-RVSDYPPPQALFQNSSN
REV--PVPLLSEEVQNEASNRPIPQQDPSSSP-LQNSHASYPSS-QGN--NFHEPVADVL
PELRED-----------------------------SLRALNDVLQV---PGR--------
----------EAWTTVLSPTLMPK--TTWFTRDTNSS-----------------LVRKTT
KVW--------------------------TNKFDGLFYSWSCVP----------------
----QDRREKYFLEFVVQF------NGIL-------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------KKSVNE----G---
>gi|29423668|gb|AAO73428.1|	   249 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------MPSSENTYPRYRSQQ----RDPLHVNSPVS
AGN----------------------------------ISGVQGSRHPP------------
-------------------------SPPTPTTQP-SVNHFD-------------------
SQAERL-----------------------------NNLTLEELLDS---PGR--------
----------A-GLTRLDPKRPPG--TLSFD--DDAA-----------------VAATVR
SIF--------------------------ERDFKEPHANWSQTS----------------
----KATIDRWYETFAQVY------NWDRSINKRVRVVFEAKLKSRMTDQ--VSRWKGNW
KEKG-DEAKPKW--------IDPDVWKGLVLF-------WQDPKSEKRVTTAEML-----
-GIMIRMAKASINTVQARPHTKLVQENGVR------------------------------
---RLEKKLL------------------ISLS----------------------------
------------------------------------------------------------
-------------------C----------------------------------------
-----------------------------------
>gi|4263643|gb|AAD15365.1|	   356 residues, 50 /line  En/Spm-like transposon protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------MPSSENTYARYRSQQ----RDPLHVNSPVS
AGN----------------------------------ISGVQGSCHPP------------
-------------------------SPPTPTTQP-SVNHSD-------------------
SQAERL-----------------------------NNLTLEELLDS---PGR--------
----------A-GLTRLDPKRPPR--TLWFD--DDAA-----------------VAATVH
NIF--------------------------ERDFKEPYANWSQTS----------------
----KATIDRWYETFAQVY------NWDRSINKRVRVEFEAKLKSRMTDQ--VSRWKGNW
KEKG-DEAKLKW--------IDADVWKGLVLF-------WQDPKSEKRVITAEML-----
-GIMIRMAKASINTVKARPHTKLCEKIGEKTPDFLELLDETHRKADGSFIDGKSEEIYKQ
VTSRIERKSL------------------ICVQGTIRRALDQAER-KESQIPRNCCEG--S
TRTVVACVLRGKQ-LLAK----FARELRLFTICEKRFAR---------------------
----NLISSQVPRVWLFARD----------------------------------------
-----------------------------------
>gi|9665162|gb|AAF97346.1|AC021045_3	   334 residues, 50 /line  Hypothetical Protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------MSSSENTYARYRSQQ----GDSLHVNSPVS
AGN----------------------------------ISGVQGSRHPP------------
-------------------------SPPTPTTQP-SVNDCD-------------------
SQAERL-----------------------------NNLTLEELLDS---PGR--------
----------A-GLTRLDPKRPPG--TLWFD--DDPA-----------------VAATVR
IIF--------------------------ERDFKEPHANWSQTS----------------
----KATIDRWYETFAQVY------NWDRSINKRVRVEFEAKLKSRMTDQ--VSRWKGNW
KEKG-DEAKPKW--------IDPD------------------------------------
-----------------------CEKTGEKTPDFLELLDETHRKADGSFIDGKSEEIYKQ
VTSRIEEEESHMGSGDNPESTGSGG---LSVHAKNKIFTEVAPR-KKGRI---YGVG--S
LQFEASSVHSGPT-LPSDDPVILSAKLAAAEACIQNQAE---------------------
----KINNFDILFDYLAEKD--PALAAILR------------------------------
-----------------------------------
>gi|4406803|gb|AAD20112.1|	   365 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------MPSSENTYARYRSQQ----RDPLHVNSPVS
AGN----------------------------------ISGVQGSRHPP------------
-------------------------SSPTLTTQP-SVNHSD-------------------
SQAERL-----------------------------NNLTLEKLLDS---PGR--------
----------A-GLTRLDPKRPLG--TLWFD--DDAA-----------------VAATVR
SIF--------------------------ERDFKEPHANWSQTS----------------
----KATIDRWYETFASNN------NRN--------------------------------
---------ARY--------HDPD------------------------------------
-GKGIYKHCSGQTSYKARVR-KRCEKTGEKTPDFLELLDETHRKADGSFINEKSEEIYKQ
VTSRIEEEESHMGSGDNPESTGSGG---LSVHAKNKIFTEVAPR-KKGRI---YGVG--S
LHFEASSAHSGPT-LPSDDPVILSEKLAAAEACIQNQAG---------------------
----KINNFDILFDYLAEKD--PALAAILRRGSSTQTRPVSANEPPVATAPEQQANEETA
AAAALAN----------LATGSSLSSV----F---
>gi|3047062|gb|AAC13576.1|	   307 residues, 50 /line  F7N22.18 gene product [Arabidopsis thaliana]
------------------------------------------------------------
-----------------------------------------------------MGLLLHS
K-----------------------------------------------------------
------------------------------------------------------------
----------------------------INRLKA-SDNHAN-------------------
PISRRF-----------------------------NNLTLDEFLDS---PGH--------
----------A-SLTRLDPNRPPG--TLWFN--EDSS-----------------VVGTVC
SIF--------------------------ERDFKDPHAYWTMTP----------------
----QPVITCWFETFA--------------------------------------------
------------------------------------------------------------
-----------------------CEKTEETTPDFLVLLDETHRKADRTFIDGKSQEIYKE
VSSRIAEEETQLCSGESSESIASGG---LSVQAMNMIYTHVAPR-KKGRI---YVVG--S
LHLEASSAHTCLP-LPRDDPVLLSEKLAVAEACIANQAE---------------------
----KINSFGVYFDYLADKD--PVFAAIFRGASSTRTKPTSANPRPEVANLRPEV-ANLR
WATRHQLLLWALALEQ--KPVLDPLHQQHSNF---
>gi|12320823|gb|AAG50554.1|AC074228_9	   251 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------MPNAGRGGSRKRKTTPNVTQRVG--GST-T
PRPRDLPAQYNF--TLAP-TVHVPTTQPT-Q--AGVRSTSAP-HVRDYPPPLQLFQNSTT
PPQGDGAPPRSEEVHFNPPPEEPAQQDPE---SPEEPANSNPSS-QGN--NFQKEVPRTL
PELQED-----------------------------SAVALQDIMSV---PNR--------
----------EQWTCVL-------------------------------------------
------------------------------------------------------------
-------------------------------------------------------SPIP-
------RPKTEWFTRDRGSKLVRKITRIFTQKFNAPYYNWSCVPLAKRERLFLE------
------------------------------------------------------------
----------------------------------------------------------FA
VSFLTL------------------------------------------------------
-CFVQSLFYCLLKFSSLTSSFFCRKLTTRI------------------------------
-------------------------------P---
>gi|22328452|ref|NP_680643.1|	   113 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------MPNAGRGGSRKRKTTPNVTQRAG--GSTPL
GRPASLPQQYDF--TPAA------------------APQSSTTQRVDPPP----------
--------PRSEEAQFNPPPEAPLNQEQSESPNPNSQAYTHPSS-QGN--NFQEGAPQSL
SELQED------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------
>gi|15230828|ref|NP_189690.1|	   133 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
-----------------M------------VTIRRLWGDNGRKTTPNVTQRAG--GSTPA
GRPSSLPQQYDF--TPAAVTVQVSASIPP-QGAGAGASSSAP-HYRNYPPPQQLFQHSTN
QPQ------RVDPL----PPQETAQQDPPLSPDPETASHSHPSS-QGN--NFQEGIPAVL
P-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------
>gi|30693484|ref|NP_849764.1|	   168 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------MPNAGRGGSRKRKTTPNVTQRAG--GSTPA
GRPSSLPQQYDF--TPAATAVQVSASIPP-QGAGVGASSSAP-HYRNYPPPQQLFQHSTN
QPQ------RVDPL----PPQETAQQDPPLSPDPKTASHSHPSS-QGN--NFQEGIPAVL
PELQED-----------------------------SVVALNDILSV---PGR--------
----------EAWCCVL-------------------------------------------
------------------------------------------------------------
-------------------------------------------------------SPIP-
------RPKTEW------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------
>gi|9758983|dbj|BAB09493.1|	   168 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------MPNAGRGGSRKRKTTPNVTQRAG--GSTPA
GRPSSLPQQYDF--TPAAATVQVSASIPP-QGAGAGASSSAP-HYRNYPPPQQLFQHSTN
QPQ------RVDPL----PPQETAQQDPPLSLDPETASHSHPSS-QGN--NFQEGIPAVL
PELQED-----------------------------SMVALNDILSV---PGR--------
----------EAWCCLL-------------------------------------------
------------------------------------------------------------
-------------------------------------------------------SPIP-
------RPKTEW------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------
>gi|4325349|gb|AAD17347.1|	   357 residues, 50 /line  contains similarity to Petunia PTTA' (GB:AF009516) [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------MPNAGRGGSRKRKTTPNVIQRAG--GSTPA
GRPSSLPQQYDF--TPAAATVQVSASIPP-QGAGAGASSSAP-HYRNYPPPQQLFQHSTN
QPQ------RVDPL----PPQETAQQDPPLSPDPETASHSHPSS-QGN--NFQEGIPAVL
PELQED-----------------------------SVVALNDILSV---PGR--------
----------EAWCWTV-------------------------------------------
------------------------------------------------------------
-----------------------------------QYYFNEIVKRRLKDM--VSTARTT-
------REQPPW--------IGETLWGTMCAY-------WDTEAAQKRSRTYSKARLSDR
NGIGPHVHYSGPKSFQEIQD-ELEEKLGRPVHLGE-VFIETHTKSDGSFVDQKSEKIAQA
YQQNVRDRLSALEASASAVSDGSSRPPELTLDDYTAIFLE-----------------VRC
FSIIIS------------------------------------------------------
-LRVQFNILSLMSFFSISCS--PQKMIQEAILM---------------------------
-------------------------------D---
>gi|6598520|gb|AAF18624.1|	   330 residues, 50 /line  En/Spm-like transposon protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
-----------MFLSFIVSCLW--------RFTRDRGSKLVRKITRIFTQKFN--A----
------------------------------------------PYYNWSCVPVDKRE----
--------------RLFLEFA---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------VCKRRLKDM--VSTARRT-
------REQPPW--------IGETLWAVMCAY-------WDTEPAQKRSRTYSKARLSDR
NGLGPHIHFSGPKSFQEIQD-ELEEKLGRIVTIGE-VFVETHTKSDGTYVDRKAELIAQT
YEQNVRDRLSQLEAEASVVSDGTSRPRELTNEELTTIFLQSTERDSRGNP---YGLG--S
LEDTLGCANYNLPGQSSSSFLDLEERLKEAQRKIEEQAAYNEKRDSEIAAREAETARITA
EQKDKLEHLSLVEKYLRQTD--PQFLDFMASKSSTTTESLPA------------------
----------------------TPQND----Q---
>gi|9293883|dbj|BAB01786.1|	   269 residues, 50 /line  transposon protein-like [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
-----------MFTSFFVACVW--------RFTRDRGSRLVRKITRIFLQKFD--A----
------------------------------------------PFYNWSCVPVDKRE----
--------------RLFLEFAKTHHWDPLLT-----------------------------
------------------------------------------------------------
--------------GTV-------------------------------------------
------------------------------------------------------------
-----------------------------------QYYFNEIVKRRLKDM--VSTARTT-
------REQPPW--------IGETLWGTMCAY-------WDTEAAQKRSRTYSKARLSDR
NGIGPHVHYSGPKSFQEIQD-ELEEKLGRPVHLGE-VFIETHTKSDGSFVDQKSEKIAQA
YQQNVRDRLSALEASASAVSDGSSRPPELTLDDYTAIFLESTEKDSRGNP---YGLG--C
LKDTLGSANRNHSG-SSSSFQALEERL---------------------------------
------------------------------------------------------------
-----------------------------------
>gi|9758982|dbj|BAB09492.1|	   305 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
-----------MFTSFFVACVW--------RFTRDRGSRLVRKITRIFLQKFD--A----
------------------------------------------PFYNWSCMPVDKRE----
--------------RLFLKFAKTHHWDPLIT-----------------------------
------------------------------------------------------------
--------------RTV-------------------------------------------
------------------------------------------------------------
-----------------------------------QYYFNEIVKRRLKDM--VSTARTT-
------REQPPW--------IGETLWGTMCAY-------WDTEAAQKRSRTYSKARLSDR
NGIGPPVHYSGPKSFQEIQD-ELEEKLGRPVHLGE-VFIETHTKSDGSFVNQKSEKIAQA
YQQNVRDRLSALEASASAVSDGSSRPPELTLDDYTAIFLESTEKDSRGNP---FGLGLGC
LKDTLGSANRHHSG-SSSSFQALEERLQEAQRKIEEQAAYNEKRDAEIAAREAESSRVTA
E-----------------------------------------------------------
-----------------------------------
>gi|12322481|gb|AAG51254.1|AC025781_6	   341 residues, 50 /line  unknown protein; 40022-38319 [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------MSFTGKDYSRFRSQQ----QRG---NPHSS
EGN----------------------------------TSAVHGTGQNSRPQTPINQASGA
SP-----------------------QQGNQSPNG-SVNHAN-------------------
PLASRL-----------------------------NDITLDELLDS---LGR--------
----------A-GLLRLDPNRPPG--TFWFE--DDPS-----------------VPATVR
SIF--------------------------ERDFKELHANWSMTP----------------
----QHVVDRWFETFAQMY------NWDKTINKRVKTEFEAKLKERMTDQ--VCRWKGKW
REKG-DAAMPRW--------FDPAVWAGLISF-------WRDPKSELKSINSRNARLHDP
DGLGIHKHRSGQTSYKAHAR-KRCELTGETTPNFLVLLDKTHRKPDGSFIDGKSEEIYNE
VSSRIQEESSQLCSNNTTESTASGG---GSKEEREDIWGWFIAA-R--------------
-----------------------------------SRMS---------------------
----SHWSFSS----------------------SRRS-----------------------
-------------------------------G---
>gi|3377852|gb|AAC28234.1|	   319 residues, 50 /line  contains similarity to Petunia PttA2 protein (GB:AF037337) [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------MEPC--VCRFD--DDHA-----------------VASIVW
SIF--------------------------ERDFKEPHANWTQTP----------------
----LPVIDRWYETFAQVY------NWDRAINKRVRIEFEAKLKDRMSDQ--VSRWKGKW
REKG-DAAIPRW--------FDPLVWVVLVSF-------WRDPKSELKSIDSRNARYHDP
DGLGIHKHRSGETSYKARAK-KRMRHI----ENLMVV-----------SMIKKSEEIYNE
VSSRIQEEEFQLCSDNTTESAASGG---LSVQAKNKIYAAVAPK-KKGRI---YGAG--S
LQLEASSAHIGSS-VPREDSIELSQKLAAAEALIANQAE---------------------
----KITSFDV----------------------SSRTEPVRSNLRPEVPNATTATSAGIA
HVTVEAETVGAEA-----NTGSSPSHT----F---
>gi|7523390|emb|CAB86448.1|	   389 residues, 50 /line  putative protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------MSFSGNDYSRFRAQQ----R-G---NTLVN
EGT----------------------------------SSTVQGG---------------A
SP-----------------------HDANQSPNG-SVNHAN-------------------
PLASQL-----------------------------NNMTQDELLES---LSR--------
----------A-GLPRLDPNRPPK--TLSFD--DDTS-----------------VAYTVR
SIF--------------------------ERDFKEPHANWSMPP----------------
----QSMVDRWFETFAQMY------NWDKAINKRVRTEFEAKLKERMSDQ--VSRWKGKW
REKG-DAAMPRW--------FDLEVWAGLC------------------------------
------------------------EMTGETTPDFLVLLDETHRKPDGSFIDGKSEEIYNE
LSSRIQEEASQLCSDNTTESTASAG---LSVQAKNKIYVAVAPK-KKGRI---YGAC--S
LQLEASSAHIGPS-VPREDPVEHFQKLPTAEALIANQAE---------------------
----KLSNFDVYFDYLADKD--PDFAGLFRA-GSSRTEPLSSNLRPEVPNATTGTSAEIA
HVAVEAETVAAEAVGA--NTGYSPSHI----F---
>gi|20197800|gb|AAM15255.1|	   394 residues, 50 /line  PttA-like transposon protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------SQQ----QNH---RRSPS
EGN----------------------------------GSATQGNLQTP--INSNNQADGA
SPP---------------PVNQSPRGSANQSPRG-SANHTT-------------------
PLAARF-----------------------------NDLTIEELLAS---PGR--------
----------A-GLPRLDPNRPPG--TLWFD--DDTL-----------------VAATVW
SIF--------------------------EKDFKEPHANWSQTS----------------
----VAVVDRWFETFAQVY------NWDSAINQRVRLEFKAKLKDRMSDQ--VGRWKGKW
KEKG-DEVKLRW--------INPEVWKGLVSF-------WRDPKSERKSINSRNARYHDP
DGLGIHKHRSGQTSYKARAR-RRV------------------------------------
--------------SDTTESTGSGG---LSVQAKNKIYAQVAPK-KKGRI---YGAG--S
FQHEASSAHTGPV-LPRDDPVVLSQKLAAAEALIANQAE---------------------
----KITCFDAYFDYLAEKD--PEFDALFRARPSTRTEPVSSK-PPDAPNATTA---GIG
PEAVEPEAVEPEAVVANPNTGSSPSEA----F---
>gi|12321085|gb|AAG50654.1|AC073433_6	   313 residues, 50 /line  transposon protein, putative [Arabidopsis thaliana]
MTV----------------------PKKKKHKMNSANLLMALRSSSPVSCFFSAVKNPHR
ID-------------------------------------------------PNNGLPENP
NFLCLKSSHRVFSGDNPIFFAASHVSSICKMTFSGNEYTRFRSQK----QHQQRPHTSVS
EEN----------------------------------TSTVQGNRRTFAPQ----TVDGA
SPP---------------PK--------NQSPQP-FVNHTN-------------------
PLAARL-----------------------------NNMTLEELLKS---PGC--------
----------A-SLPRLDHNRLLG--TLWFD--EDPS-----------------VAATVW
SIF--------------------------ERDFKEPHS-WTFID----------------
----RKSEEIYKEVSSRIQAEESHLCTGDTMESTASGGLSVQAKNK---------IYAQF
LVGCSEEERKHY--------KKIVALRGNIAR-------EEIPRK---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------FARVLQVIC
YETDARCIPVAKLRGKY--------------E---
>gi|89257612|gb|ABD65100.1|	   391 residues, 50 /line  hypothetical protein 31.t00077 [Brassica oleracea]
MGIWVSGFGFGVSGLGFGVSGFGFGVSGFGFGVSGFGLGVSGFGFRGWSFGFGVSSFGFR
VSGFGFWVSGFGVGVSGFGFGVSGFGFGVSGFGFGEYGVWGFGFGVSGFGVGVSGFGFGV
SGFGVGVSGFGFGVSGLGFGVSGFGFGVRKGRLTAHYREIFG-----------EPGSRLD
PASSSAPSSSGQETVPETQY-----------------TQRVSGSTSSSAPS----APHVP
PPM---------------PP----PVP-PPMAPP-MVADIHPDL-M-------------V
PPSAPY-----------------------------SQYTVEDILSL---PGR--------
----------E-GLPVIDPDRPDG--TLWWG--VDGC-----------------LASDVT
DTI--------------------------KGYFSMAHPNWSKTP----------------
----HYVRKTWFKIYAQKY------NWALGITERVRKKFNAKAKVRLLDT--VSNWKGDW
IVKGYERGKPAE--------LTTDVWDGLIRY-------WRLPDS---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------I--------
--------RIAQACCRI--------------PDPE
>gi|123205416|ref|XP_001284665.1|	   358 residues, 50 /line  hypothetical protein TVAG_505330 [Trichomonas vaginalis G3]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------HA
PKPTQQPTVQNP--APQQQP-KPTVQNPA-QQPTVQNPAQQ-PTVQNPAPQQQPTQQPQ-
------------------PTQQPTVQNPAQQPTVQNPAQQQPQTEQGHKRSREKGNQEFL
KMLKEDYGYPDTLDFSDRYKEAIRKFKEGNTDPNLFSFMVQHQMGYNLKPGKYKLAKGYD
LIAYHPNDMNE-FTPRYLVSELNDNSTLFMKRV-KNRDGTKEERFMSPDDLDRELVKNGL
GIYEMPADEVQETQQEEVQIQPDMEEIVQQQQLEEPEGNEQVPPLETNFTELDEDLEQPK
NLDPQQVYEENMESFQESK------KNSADIVEEYRKMFTDIQKTPTSDENIQHRMEV--
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------LKENVRKYNNPF
TYDHITFNLWLNSVKIK-----------------G
>gi|26451632|dbj|BAC42913.1|	   129 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------MPPHENPNVDSDADNEPPM----------------
----------------------------------DYDEMVEYMLGL---PGR--------
----------E-HLPRLSRTQIPGVETIWFGRD-KGK-----------------LSRTIA
GIF--------------------------RAKFDGPYFSWKVTP----------------
----ISIQQRYFKAFAGKF------NWDIGLTELVREGFLVIAKKRLKGI--VSQAKK--
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.