Fandom

Proteins Wiki

At2g10070.1/MSA

< At2g10070.1

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|15226699|ref|NP_178832.1|	   150 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------------------------MGKRINPLPPQYNFTPADNNPPPQSSQERVRVQ
PQQARSFTPRVSDYPPPQALFQNSSNREV--PVPLLSEEVQNEASNRPIPQQDPSSSP-L
QNSHASYPSSQGNNFHEPVADVLPELREDSLRALNDVLQVPGREAWTTVLSPTLMPKTTW
------------------------------------------------------------
--------------------
>gi|12320823|gb|AAG50554.1|AC074228_9	   251 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
-MPNAGRGGSRKRKTTPNVTQRVGGSTT-PRPRDLPAQYNFTLAP-TVHVPTTQPT-Q-A
GV-RSTSAPHVRDYPPPLQLFQNSTTPPQGDGAPPRSEEVHFNPPPEEPAQQDPE---SP
EEPANSNPSSQGNNFQKEVPRTLPELQEDSAVALQDIMSVPNREQWTCVLSPIPRPKTEW
FTRDRGSKLVRKITRIFTQKFNAPYYNWSCVPLAKRERLFLEFAVSFLTLCFVQSLFYCL
LKFSSLTSSFFCRKLTTRIP
>gi|22328452|ref|NP_680643.1|	   113 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-MPNAGRGGSRKRKTTPNVTQRAGGSTPLGRPASLPQQYDFTPAAA---------P-Q--
-----SSTTQRVDPPPPR-SEEAQFNP-----------------PPEAPLNQEQSESPNP
NSQAYTHPSSQGNNFQEGAPQSLSELQED-------------------------------
------------------------------------------------------------
--------------------
>gi|15230828|ref|NP_189690.1|	   133 residues, 50 /line  unknown protein [Arabidopsis thaliana]
MVTIRRLWGDNGRKTTPNVTQRAGGSTPAGRPSSLPQQYDFTPAAVTVQVSASIPP-QGA
GAGASSSAPHYRNYPPPQQLFQHSTNQPQ------RVDPL----PPQETAQQDPPLSPDP
ETASHSHPSSQGNNFQEGIPAVLP------------------------------------
------------------------------------------------------------
--------------------
>gi|30693484|ref|NP_849764.1|	   168 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-MPNAGRGGSRKRKTTPNVTQRAGGSTPAGRPSSLPQQYDFTPAATAVQVSASIPP-QGA
GVGASSSAPHYRNYPPPQQLFQHSTNQPQ------RVDPL----PPQETAQQDPPLSPDP
KTASHSHPSSQGNNFQEGIPAVLPELQEDSVVALNDILSVPGREAWCCVLSPIPRPKTEW
------------------------------------------------------------
--------------------
>gi|9758983|dbj|BAB09493.1|	   168 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
-MPNAGRGGSRKRKTTPNVTQRAGGSTPAGRPSSLPQQYDFTPAAATVQVSASIPP-QGA
GAGASSSAPHYRNYPPPQQLFQHSTNQPQ------RVDPL----PPQETAQQDPPLSLDP
ETASHSHPSSQGNNFQEGIPAVLPELQEDSMVALNDILSVPGREAWCCLLSPIPRPKTEW
------------------------------------------------------------
--------------------


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.