FANDOM


&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g09910-1clg_A.pir.txt

======================================================

Assigned types to 985 residues in Sequence 2-09910, 4 remain unknown
Assigned types to 280 residues in Sequence 1c1g_A, 709 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 641  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 642  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 682  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 735  All residues are positively and negatively charged

Translated sequence file At2g09910-1clg_A.pir.txt into sequence alignment.

======================================================

>1C1G.pdb  Made from 9160 ATOM records in 1C1G.pdb
MDAIKKKMQMLKLDKENALDRADEAEADKKAAEDRSKQLEDELVSLQKKL
KATEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLFEEELD
RAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKE
AKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEEIKTV
TNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLE
KSIDDLEDELYAQKLKYKAISEELDHALNDMTSIMDAIKKKMQMLKLDKE
NALDRADEAEADKKAAEDRSKQLEDELVSLQKKLKATEDELDKYSEALKD
AQEKLELAEKKATDAEADVASLNRRIQLFEEELDRAQERLATALQKLEEA
EKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVA
RKLVIIESDLERAEERAELSEGKCAELEEEIKTVTNNLKSLEAQAEKYSQ
KEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLK
YKAISEELDHALNDMTSIMDAIKKKMQMLKLDKENALDRADEAEADKKAA
EDRSKQLEDELVSLQKKLKATEDELDKYSEALKDAQEKLELAEKKATDAE
ADVASLNRRIQLFEEELDRAQERLATALQKLEEAEKAADESERGMKVIES
RAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEER
AELSEGKCAELEEEIKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKL
KEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMT
SIMDAIKKKMQMLKLDKENALDRADEAEADKKAAEDRSKQLEDELVSLQK
KLKATEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLFEEE
LDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQL
KEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEEIK
TVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTK
LEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI

======================================================

Best alignment:
1C1G.pdb    26  EADKKAAEDRSKQLEDELVSLQKKLKATEDELDKYS-EALK-DAQEKLEL    73
                +A +   E+ +  L+ E  +    + A    +D+ S E +  D+Q++  L
2-09910    313  QAQRPPIEEETHPLDGEAATSNPPVSAGPSGVDQVSHETVNPDSQDRTRL   362

1C1G.pdb    74  AEKKATDA-EADVASLNRRIQLFEEELDRAQERLATALQKLEEAEKAADE   122
                       A E      ++ +Q+ E E+       + A   +  A  A +E
2-09910    363  EGADVVPAQEIAECDQSQSVQVVEPEIQNVTSDRSIA---VYAAVPAGEE   409

1C1G.pdb   123  SERGMKVIESRAQKDEEKMEIQEIQLKE-AKHIAEDADRKYEEVARKLVI   171
                   G+ +++    +  E++E      +E  K +A  + ++    A    +
2-09910    410  VNTGLVIVDQDKDETVEELETSRRSREEKGKGVANQSKKRSASEAGLDEV   459

1C1G.pdb   172  IESDLERAEERAELSEGKCAELEEEIKTVTNNLKSLEAQAEKYSQKEDKY   221
                      R      L+  + +      K +   ++  EA +  +       
2-09910    460  AAPKTFRLSRGETLNSDQFSFKYSGAKFL---VRDQEAASHLWRNLMLPG   506

1C1G.pdb   222  EEEIKVLSD-KLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAI   270
                 ++   L D  LKE   +   +      L   +    D     KL  +  
2-09910    507  TKDFPNLDDLVLKEGYQKFARSSLETAALANDLIATYDRKLKLKLADREA   556

1C1G.pdb   271  SEELDHALNDMTSIMDAIKKKMQMLKLDKENALDRADEAEADKKAAEDRS   320
                 + L    +   +I     K+M  L+   E           + K    R 
2-09910    557  FDNLKKCADQAKAIYAKDMKEMAALRDAAEIHKAEMSSLNDEVKRLNGRE   606

1C1G.pdb   321  KQLEDELVSLQKKLKATEDELDKYSEALK-DAQEKLELAEKKATDAEADV   369
                  L+ E+  LQ  L A ++  +K    L+ D   K+    KKA      V
2-09910    607  ADLQKEISDLQVALVAVKEHGEKECNRLRNDLVAKVARTTKKAQARLDKV   656

1C1G.pdb   369  -ASLNRRIQLFEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRA   418
                 A L  +  L   ++D   E  A   +++E  ++A DE    + VIE   
2-09910    657  KAYLKEQEDLVGPKVD--VENQAKGAEEIELTKRATDE-VNALNVIE--L   701

1C1G.pdb   419  QKDEEKMEIQEIQ-LKEAKHIAEDADRKYEEVARKLVIIESDLERAEERA   467
                  D+  M   ++  L++A  IA  AD     V    ++  SD+ R E   
2-09910    702  GDDDLNMSPDQLGFLRQASQIAPVADHHSSNV---DLVSGSDIRRMESAG   748

1C1G.pdb   468  ELS   470
                  S
2-09910    749  SSS   751

======================================================

Highlighted IDENTICAL residue GLU   26  index1   26  path  313  %Seq  50.00
Highlighted IDENTICAL residue ALA   27  index1   27  path  314  %Seq  50.00
Highlighted IDENTICAL residue ASP   28  index1   28  path  315  %Seq  50.00
Highlighted IDENTICAL residue LYS   29  index1   29  path  316  %Seq  50.00
Highlighted IDENTICAL residue LYS   30  index1   30  path  317  %Seq  50.00
Highlighted IDENTICAL residue ALA   31  index1   31  path  318  %Seq  50.00
Highlighted IDENTICAL residue ALA   32  index1   32  path  319  %Seq  50.00
Highlighted IDENTICAL residue GLU   33  index1   33  path  320  %Seq  50.00
Highlighted IDENTICAL residue ASP   34  index1   34  path  321  %Seq  50.00
Highlighted IDENTICAL residue ARG   35  index1   35  path  322  %Seq  50.00
Highlighted IDENTICAL residue SER   36  index1   36  path  323  %Seq  50.00
Highlighted IDENTICAL residue LYS   37  index1   37  path  324  %Seq  50.00
Highlighted IDENTICAL residue GLN   38  index1   38  path  325  %Seq  50.00
Highlighted IDENTICAL residue LEU   39  index1   39  path  326  %Seq  50.00
Highlighted IDENTICAL residue GLU   40  index1   40  path  327  %Seq  50.00
Highlighted IDENTICAL residue ASP   41  index1   41  path  328  %Seq  50.00
Highlighted IDENTICAL residue GLU   42  index1   42  path  329  %Seq  50.00
Highlighted IDENTICAL residue LEU   43  index1   43  path  330  %Seq  50.00
Highlighted IDENTICAL residue VAL   44  index1   44  path  331  %Seq  50.00
Highlighted IDENTICAL residue SER   45  index1   45  path  332  %Seq  50.00
Highlighted IDENTICAL residue LEU   46  index1   46  path  333  %Seq  50.00
Highlighted IDENTICAL residue GLN   47  index1   47  path  334  %Seq  50.00
Highlighted IDENTICAL residue LYS   48  index1   48  path  335  %Seq  50.00
Highlighted IDENTICAL residue LYS   49  index1   49  path  336  %Seq  50.00
Highlighted IDENTICAL residue LEU   50  index1   50  path  337  %Seq  50.00
Highlighted IDENTICAL residue LYS   51  index1   51  path  338  %Seq  50.00
Highlighted IDENTICAL residue ALA   52  index1   52  path  339  %Seq  50.00
Highlighted IDENTICAL residue THR   53  index1   53  path  340  %Seq  50.00
Highlighted IDENTICAL residue GLU   54  index1   54  path  341  %Seq  50.00
Highlighted IDENTICAL residue ASP   55  index1   55  path  342  %Seq  50.00
Highlighted IDENTICAL residue GLU   56  index1   56  path  343  %Seq  50.00
Highlighted IDENTICAL residue LEU   57  index1   57  path  344  %Seq  50.00
Highlighted IDENTICAL residue ASP   58  index1   58  path  345  %Seq  50.00
Highlighted IDENTICAL residue LYS   59  index1   59  path  346  %Seq  50.00
Highlighted IDENTICAL residue TYR   60  index1   60  path  347  %Seq  50.00
Highlighted IDENTICAL residue SER   61  index1   61  path  348  %Seq  50.00
Highlighted IDENTICAL residue GLU   62  index1   62  path  350  %Seq  50.00
Highlighted IDENTICAL residue ALA   63  index1   63  path  351  %Seq  50.00
Highlighted IDENTICAL residue LEU   64  index1   64  path  352  %Seq  50.00
Highlighted IDENTICAL residue LYS   65  index1   65  path  353  %Seq  50.00
Highlighted IDENTICAL residue ASP   66  index1   66  path  355  %Seq  50.00
Highlighted IDENTICAL residue ALA   67  index1   67  path  356  %Seq  50.00
Highlighted IDENTICAL residue GLN   68  index1   68  path  357  %Seq  50.00
Highlighted IDENTICAL residue GLU   69  index1   69  path  358  %Seq  50.00
Highlighted IDENTICAL residue LYS   70  index1   70  path  359  %Seq  50.00
Highlighted IDENTICAL residue LEU   71  index1   71  path  360  %Seq  50.00
Highlighted IDENTICAL residue GLU   72  index1   72  path  361  %Seq  50.00
Highlighted IDENTICAL residue LEU   73  index1   73  path  362  %Seq  50.00
Highlighted IDENTICAL residue ALA   74  index1   74  path  363  %Seq  50.00
Highlighted IDENTICAL residue GLU   75  index1   75  path  364  %Seq  50.00
Highlighted IDENTICAL residue LYS   76  index1   76  path  365  %Seq  50.00
Highlighted IDENTICAL residue LYS   77  index1   77  path  366  %Seq  50.00
Highlighted IDENTICAL residue ALA   78  index1   78  path  367  %Seq  50.00
Highlighted IDENTICAL residue THR   79  index1   79  path  368  %Seq  50.00
Highlighted IDENTICAL residue ASP   80  index1   80  path  369  %Seq  50.00
Highlighted IDENTICAL residue ALA   81  index1   81  path  370  %Seq  50.00
Highlighted IDENTICAL residue GLU   82  index1   82  path  372  %Seq  50.00
Highlighted IDENTICAL residue ALA   83  index1   83  path  373  %Seq  50.00
Highlighted IDENTICAL residue ASP   84  index1   84  path  374  %Seq  50.00
Highlighted IDENTICAL residue VAL   85  index1   85  path  375  %Seq  50.00
Highlighted IDENTICAL residue ALA   86  index1   86  path  376  %Seq  50.00
Highlighted IDENTICAL residue SER   87  index1   87  path  377  %Seq  50.00
Highlighted IDENTICAL residue LEU   88  index1   88  path  378  %Seq  50.00
Highlighted IDENTICAL residue ASN   89  index1   89  path  379  %Seq  50.00
Highlighted IDENTICAL residue ARG   90  index1   90  path  380  %Seq  50.00
Highlighted IDENTICAL residue ARG   91  index1   91  path  381  %Seq  50.00
Highlighted IDENTICAL residue ILE   92  index1   92  path  382  %Seq  50.00
Highlighted IDENTICAL residue GLN   93  index1   93  path  383  %Seq  50.00
Highlighted IDENTICAL residue LEU   94  index1   94  path  384  %Seq  50.00
Highlighted IDENTICAL residue PHE   95  index1   95  path  385  %Seq  50.00
Highlighted IDENTICAL residue GLU   96  index1   96  path  386  %Seq  50.00
Highlighted IDENTICAL residue GLU   97  index1   97  path  387  %Seq  50.00
Highlighted IDENTICAL residue GLU   98  index1   98  path  388  %Seq  50.00
Highlighted IDENTICAL residue LEU   99  index1   99  path  389  %Seq  50.00
Highlighted IDENTICAL residue ASP  100  index1  100  path  390  %Seq  50.00
Highlighted IDENTICAL residue ARG  101  index1  101  path  391  %Seq  50.00
Highlighted IDENTICAL residue ALA  102  index1  102  path  392  %Seq  50.00
Highlighted IDENTICAL residue GLN  103  index1  103  path  393  %Seq  50.00
Highlighted IDENTICAL residue GLU  104  index1  104  path  394  %Seq  50.00
Highlighted IDENTICAL residue ARG  105  index1  105  path  395  %Seq  50.00
Highlighted IDENTICAL residue LEU  106  index1  106  path  396  %Seq  50.00
Highlighted IDENTICAL residue ALA  107  index1  107  path  397  %Seq  50.00
Highlighted IDENTICAL residue THR  108  index1  108  path  398  %Seq  50.00
Highlighted IDENTICAL residue ALA  109  index1  109  path  399  %Seq  50.00
Highlighted IDENTICAL residue LEU  113  index1  113  path  400  %Seq  50.00
Highlighted IDENTICAL residue GLU  114  index1  114  path  401  %Seq  50.00
Highlighted IDENTICAL residue GLU  115  index1  115  path  402  %Seq  50.00
Highlighted IDENTICAL residue ALA  116  index1  116  path  403  %Seq  50.00
Highlighted IDENTICAL residue GLU  117  index1  117  path  404  %Seq  50.00
Highlighted IDENTICAL residue LYS  118  index1  118  path  405  %Seq  50.00
Highlighted IDENTICAL residue ALA  119  index1  119  path  406  %Seq  50.00
Highlighted IDENTICAL residue ALA  120  index1  120  path  407  %Seq  50.00
Highlighted IDENTICAL residue ASP  121  index1  121  path  408  %Seq  50.00
Highlighted IDENTICAL residue GLU  122  index1  122  path  409  %Seq  50.00
Highlighted IDENTICAL residue SER  123  index1  123  path  410  %Seq  50.00
Highlighted IDENTICAL residue GLU  124  index1  124  path  411  %Seq  50.00
Highlighted IDENTICAL residue ARG  125  index1  125  path  412  %Seq  50.00
Highlighted IDENTICAL residue GLY  126  index1  126  path  413  %Seq  50.00
Highlighted IDENTICAL residue MET  127  index1  127  path  414  %Seq  50.00
Highlighted IDENTICAL residue LYS  128  index1  128  path  415  %Seq  50.00
Highlighted IDENTICAL residue VAL  129  index1  129  path  416  %Seq  50.00
Highlighted IDENTICAL residue ILE  130  index1  130  path  417  %Seq  50.00
Highlighted IDENTICAL residue GLU  131  index1  131  path  418  %Seq  50.00
Highlighted IDENTICAL residue SER  132  index1  132  path  419  %Seq  50.00
Highlighted IDENTICAL residue ARG  133  index1  133  path  420  %Seq  50.00
Highlighted IDENTICAL residue ALA  134  index1  134  path  421  %Seq  50.00
Highlighted IDENTICAL residue GLN  135  index1  135  path  422  %Seq  50.00
Highlighted IDENTICAL residue LYS  136  index1  136  path  423  %Seq  50.00
Highlighted IDENTICAL residue ASP  137  index1  137  path  424  %Seq  50.00
Highlighted IDENTICAL residue GLU  138  index1  138  path  425  %Seq  50.00
Highlighted IDENTICAL residue GLU  139  index1  139  path  426  %Seq  50.00
Highlighted IDENTICAL residue LYS  140  index1  140  path  427  %Seq  50.00
Highlighted IDENTICAL residue MET  141  index1  141  path  428  %Seq  50.00
Highlighted IDENTICAL residue GLU  142  index1  142  path  429  %Seq  50.00
Highlighted IDENTICAL residue ILE  143  index1  143  path  430  %Seq  50.00
Highlighted IDENTICAL residue GLN  144  index1  144  path  431  %Seq  50.00
Highlighted IDENTICAL residue GLU  145  index1  145  path  432  %Seq  50.00
Highlighted IDENTICAL residue ILE  146  index1  146  path  433  %Seq  50.00
Highlighted IDENTICAL residue GLN  147  index1  147  path  434  %Seq  50.00
Highlighted IDENTICAL residue LEU  148  index1  148  path  435  %Seq  50.00
Highlighted IDENTICAL residue LYS  149  index1  149  path  436  %Seq  50.00
Highlighted IDENTICAL residue GLU  150  index1  150  path  437  %Seq  50.00
Highlighted IDENTICAL residue ALA  151  index1  151  path  439  %Seq  50.00
Highlighted IDENTICAL residue LYS  152  index1  152  path  440  %Seq  50.00
Highlighted IDENTICAL residue HIS  153  index1  153  path  441  %Seq  50.00
Highlighted IDENTICAL residue ILE  154  index1  154  path  442  %Seq  50.00
Highlighted IDENTICAL residue ALA  155  index1  155  path  443  %Seq  50.00
Highlighted IDENTICAL residue GLU  156  index1  156  path  444  %Seq  50.00
Highlighted IDENTICAL residue ASP  157  index1  157  path  445  %Seq  50.00
Highlighted IDENTICAL residue ALA  158  index1  158  path  446  %Seq  50.00
Highlighted IDENTICAL residue ASP  159  index1  159  path  447  %Seq  50.00
Highlighted IDENTICAL residue ARG  160  index1  160  path  448  %Seq  50.00
Highlighted IDENTICAL residue LYS  161  index1  161  path  449  %Seq  50.00
Highlighted IDENTICAL residue TYR  162  index1  162  path  450  %Seq  50.00
Highlighted IDENTICAL residue GLU  163  index1  163  path  451  %Seq  50.00
Highlighted IDENTICAL residue GLU  164  index1  164  path  452  %Seq  50.00
Highlighted IDENTICAL residue VAL  165  index1  165  path  453  %Seq  50.00
Highlighted IDENTICAL residue ALA  166  index1  166  path  454  %Seq  50.00
Highlighted IDENTICAL residue ARG  167  index1  167  path  455  %Seq  50.00
Highlighted IDENTICAL residue LYS  168  index1  168  path  456  %Seq  50.00
Highlighted IDENTICAL residue LEU  169  index1  169  path  457  %Seq  50.00
Highlighted IDENTICAL residue VAL  170  index1  170  path  458  %Seq  50.00
Highlighted IDENTICAL residue ILE  171  index1  171  path  459  %Seq  50.00
Highlighted IDENTICAL residue ILE  172  index1  172  path  460  %Seq  50.00
Highlighted IDENTICAL residue GLU  173  index1  173  path  461  %Seq  50.00
Highlighted IDENTICAL residue SER  174  index1  174  path  462  %Seq  50.00
Highlighted IDENTICAL residue ASP  175  index1  175  path  463  %Seq  50.00
Highlighted IDENTICAL residue LEU  176  index1  176  path  464  %Seq  50.00
Highlighted IDENTICAL residue GLU  177  index1  177  path  465  %Seq  50.00
Highlighted IDENTICAL residue ARG  178  index1  178  path  466  %Seq  50.00
Highlighted IDENTICAL residue ALA  179  index1  179  path  467  %Seq  50.00
Highlighted IDENTICAL residue GLU  180  index1  180  path  468  %Seq  50.00
Highlighted IDENTICAL residue GLU  181  index1  181  path  469  %Seq  50.00
Highlighted IDENTICAL residue ARG  182  index1  182  path  470  %Seq  50.00
Highlighted IDENTICAL residue ALA  183  index1  183  path  471  %Seq  50.00
Highlighted IDENTICAL residue GLU  184  index1  184  path  472  %Seq  50.00
Highlighted IDENTICAL residue LEU  185  index1  185  path  473  %Seq  50.00
Highlighted IDENTICAL residue SER  186  index1  186  path  474  %Seq  50.00
Highlighted IDENTICAL residue GLU  187  index1  187  path  475  %Seq  50.00
Highlighted IDENTICAL residue GLY  188  index1  188  path  476  %Seq  50.00
Highlighted IDENTICAL residue LYS  189  index1  189  path  477  %Seq  50.00
Highlighted IDENTICAL residue CYS  190  index1  190  path  478  %Seq  50.00
Highlighted IDENTICAL residue ALA  191  index1  191  path  479  %Seq  50.00
Highlighted IDENTICAL residue GLU  192  index1  192  path  480  %Seq  50.00
Highlighted IDENTICAL residue LEU  193  index1  193  path  481  %Seq  50.00
Highlighted IDENTICAL residue GLU  194  index1  194  path  482  %Seq  50.00
Highlighted IDENTICAL residue GLU  195  index1  195  path  483  %Seq  50.00
Highlighted IDENTICAL residue GLU  196  index1  196  path  484  %Seq  50.00
Highlighted IDENTICAL residue ILE  197  index1  197  path  485  %Seq  50.00
Highlighted IDENTICAL residue LYS  198  index1  198  path  486  %Seq  50.00
Highlighted IDENTICAL residue THR  199  index1  199  path  487  %Seq  50.00
Highlighted IDENTICAL residue VAL  200  index1  200  path  488  %Seq  50.00
Highlighted IDENTICAL residue LEU  204  index1  204  path  489  %Seq  50.00
Highlighted IDENTICAL residue LYS  205  index1  205  path  490  %Seq  50.00
Highlighted IDENTICAL residue SER  206  index1  206  path  491  %Seq  50.00
Highlighted IDENTICAL residue LEU  207  index1  207  path  492  %Seq  50.00
Highlighted IDENTICAL residue GLU  208  index1  208  path  493  %Seq  50.00
Highlighted IDENTICAL residue ALA  209  index1  209  path  494  %Seq  50.00
Highlighted IDENTICAL residue GLN  210  index1  210  path  495  %Seq  50.00
Highlighted IDENTICAL residue ALA  211  index1  211  path  496  %Seq  50.00
Highlighted IDENTICAL residue GLU  212  index1  212  path  497  %Seq  50.00
Highlighted IDENTICAL residue LYS  213  index1  213  path  498  %Seq  50.00
Highlighted IDENTICAL residue TYR  214  index1  214  path  499  %Seq  50.00
Highlighted IDENTICAL residue SER  215  index1  215  path  500  %Seq  50.00
Highlighted IDENTICAL residue GLN  216  index1  216  path  501  %Seq  50.00
Highlighted IDENTICAL residue LYS  217  index1  217  path  502  %Seq  50.00
Highlighted IDENTICAL residue GLU  218  index1  218  path  503  %Seq  50.00
Highlighted IDENTICAL residue ASP  219  index1  219  path  504  %Seq  50.00
Highlighted IDENTICAL residue LYS  220  index1  220  path  505  %Seq  50.00
Highlighted IDENTICAL residue TYR  221  index1  221  path  506  %Seq  50.00
Highlighted IDENTICAL residue GLU  222  index1  222  path  507  %Seq  50.00
Highlighted IDENTICAL residue GLU  223  index1  223  path  508  %Seq  50.00
Highlighted IDENTICAL residue GLU  224  index1  224  path  509  %Seq  50.00
Highlighted IDENTICAL residue ILE  225  index1  225  path  510  %Seq  50.00
Highlighted IDENTICAL residue LYS  226  index1  226  path  511  %Seq  50.00
Highlighted IDENTICAL residue VAL  227  index1  227  path  512  %Seq  50.00
Highlighted IDENTICAL residue LEU  228  index1  228  path  513  %Seq  50.00
Highlighted IDENTICAL residue SER  229  index1  229  path  514  %Seq  50.00
Highlighted IDENTICAL residue ASP  230  index1  230  path  515  %Seq  50.00
Highlighted IDENTICAL residue LYS  231  index1  231  path  517  %Seq  50.00
Highlighted IDENTICAL residue LEU  232  index1  232  path  518  %Seq  50.00
Highlighted IDENTICAL residue LYS  233  index1  233  path  519  %Seq  50.00
Highlighted IDENTICAL residue GLU  234  index1  234  path  520  %Seq  50.00
Highlighted IDENTICAL residue ALA  235  index1  235  path  521  %Seq  50.00
Highlighted IDENTICAL residue GLU  236  index1  236  path  522  %Seq  50.00
Highlighted IDENTICAL residue THR  237  index1  237  path  523  %Seq  50.00
Highlighted IDENTICAL residue ARG  238  index1  238  path  524  %Seq  50.00
Highlighted IDENTICAL residue ALA  239  index1  239  path  525  %Seq  50.00
Highlighted IDENTICAL residue GLU  240  index1  240  path  526  %Seq  50.00
Highlighted IDENTICAL residue PHE  241  index1  241  path  527  %Seq  50.00
Highlighted IDENTICAL residue ALA  242  index1  242  path  528  %Seq  50.00
Highlighted IDENTICAL residue GLU  243  index1  243  path  529  %Seq  50.00
Highlighted IDENTICAL residue ARG  244  index1  244  path  530  %Seq  50.00
Highlighted IDENTICAL residue SER  245  index1  245  path  531  %Seq  50.00
Highlighted IDENTICAL residue VAL  246  index1  246  path  532  %Seq  50.00
Highlighted IDENTICAL residue THR  247  index1  247  path  533  %Seq  50.00
Highlighted IDENTICAL residue LYS  248  index1  248  path  534  %Seq  50.00
Highlighted IDENTICAL residue LEU  249  index1  249  path  535  %Seq  50.00
Highlighted IDENTICAL residue GLU  250  index1  250  path  536  %Seq  50.00
Highlighted IDENTICAL residue LYS  251  index1  251  path  537  %Seq  50.00
Highlighted IDENTICAL residue SER  252  index1  252  path  538  %Seq  50.00
Highlighted IDENTICAL residue ILE  253  index1  253  path  539  %Seq  50.00
Highlighted IDENTICAL residue ASP  254  index1  254  path  540  %Seq  50.00
Highlighted IDENTICAL residue ASP  255  index1  255  path  541  %Seq  50.00
Highlighted IDENTICAL residue LEU  256  index1  256  path  542  %Seq  50.00
Highlighted IDENTICAL residue GLU  257  index1  257  path  543  %Seq  50.00
Highlighted IDENTICAL residue ASP  258  index1  258  path  544  %Seq  50.00
Highlighted IDENTICAL residue GLU  259  index1  259  path  545  %Seq  50.00
Highlighted IDENTICAL residue LEU  260  index1  260  path  546  %Seq  50.00
Highlighted IDENTICAL residue TYR  261  index1  261  path  547  %Seq  50.00
Highlighted IDENTICAL residue ALA  262  index1  262  path  548  %Seq  50.00
Highlighted IDENTICAL residue GLN  263  index1  263  path  549  %Seq  50.00
Highlighted IDENTICAL residue LYS  264  index1  264  path  550  %Seq  50.00
Highlighted IDENTICAL residue LEU  265  index1  265  path  551  %Seq  50.00
Highlighted IDENTICAL residue LYS  266  index1  266  path  552  %Seq  50.00
Highlighted IDENTICAL residue TYR  267  index1  267  path  553  %Seq  50.00
Highlighted IDENTICAL residue LYS  268  index1  268  path  554  %Seq  50.00
Highlighted IDENTICAL residue ALA  269  index1  269  path  555  %Seq  50.00
Highlighted IDENTICAL residue ILE  270  index1  270  path  556  %Seq  50.00
Highlighted IDENTICAL residue GLU  272  index1  272  path  558  %Seq 100.00
Highlighted IDENTICAL residue ASP  275  index1  275  path  561  %Seq 100.00
Highlighted IDENTICAL residue HIS  276  index1  276  path  562  %Seq 100.00
Highlighted IDENTICAL residue THR  282  index1  282  path  568  %Seq 100.00
Highlighted IDENTICAL residue ALA  309  index1  309  path  595  %Seq 100.00
Highlighted IDENTICAL residue ALA  311  index1  311  path  597  %Seq 100.00
Highlighted IDENTICAL residue ASP  312  index1  312  path  598  %Seq 100.00
Highlighted IDENTICAL residue ALA  316  index1  316  path  602  %Seq 100.00
Highlighted IDENTICAL residue GLU  326  index1  326  path  612  %Seq 100.00
Highlighted IDENTICAL residue LYS  333  index1  333  path  619  %Seq 100.00
Highlighted IDENTICAL residue LEU  334  index1  334  path  620  %Seq 100.00
Highlighted IDENTICAL residue ASP  339  index1  339  path  625  %Seq 100.00
Highlighted IDENTICAL residue ASP  342  index1  342  path  628  %Seq 100.00
Highlighted IDENTICAL residue LEU  357  index1  357  path  646  %Seq 100.00
Highlighted IDENTICAL residue GLU  366  index1  366  path  655  %Seq 100.00
Highlighted IDENTICAL residue ALA  367  index1  367  path  656  %Seq 100.00
Highlighted IDENTICAL residue LEU  372  index1  372  path  662  %Seq 100.00
Highlighted IDENTICAL residue LEU  397  index1  397  path  686  %Seq 100.00
Highlighted IDENTICAL residue GLU  398  index1  398  path  687  %Seq 100.00
Highlighted IDENTICAL residue GLU  406  index1  406  path  695  %Seq 100.00
Highlighted IDENTICAL residue ILE  414  index1  414  path  702  %Seq 100.00
Highlighted IDENTICAL residue ALA  418  index1  418  path  704  %Seq 100.00
Highlighted IDENTICAL residue ALA  435  index1  435  path  722  %Seq 100.00
Highlighted 262 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g09910-1clg_A.pir.txt.1C1G.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g09910-1clg_A.pir.txt PIR amino_acid 1C1G.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.