FANDOM


>gi|15226667|ref|NP_178823.1|	   985 residues, 50 /line  unknown protein [Arabidopsis thaliana]
MGKAV-------------------LVSPSSSSSESEASLVR----RNS------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------RL
TGNPSDEAQSSRSN--RIEIPTLLDEPDRE----G-------------------------
---------SGGHPAAPEDSVDFLAQF---DPLIDLED-----AYNTHPQYTEAEVNARL
LHE---------------------------------------DYVEFDLDPIVHWNTEIT
V--------------------------------------------------------KKT
LSTTESVAEVFTLCGSGDRPL--TYMILGEDER--PWNPPR-----GYVCMYEAYFRQC-
----HLWFPIPSLIISFLN---RRRMAFSQLTPVAICNFVVALTFGAE-----EGYLVNV
RCFEEMTTLK-------AIRS--PGY--WVVNNRPK--YNFLPGPK---VSNF--KNWEE
YYFYIR--VD-----LE----SYERPFSWRKRMWT----EFPD-RYRPSPEFPMEFEGVL
EAIFQAQ----R-----------------------------------------P------
------PIEE---ETHPLDGEAATSNPPV-SAGPSG---VDQVSHETVNPDSQ------D
RTRLEGADVVPAQ-EIAECDQSQSVQVVE-PEIQNVTSDRSIA-------VYAAVPAGEE
VNTG------------------------------------------------LVIVDQDK
DETVEELETS-----RRSREEK-------------GKGVANQSKKRSASEAGLDEV----
------------------------------------------------------------
-----------------------AAPKTFRLSRG--------------------------
-----------------------------------ETLNSDQFSFKY-SGAKFLVRDQEA
ASHL-----------------WRNLMLPGTKDFPNLDDLVLKEGYQKFARSSL-------
----------------ETAA-LANDLIATYDRKLK------L-KLADREAFD--------
------NLKKCADQAKAIYAKDMKEMAALRDAAEIHKAE-------MSSLNDEVKRLNGR
EADLQKEIS-----------------------------------DLQVALVAVKEHGEKE
CNRLRNDLVAKVARTTKKAQARLDKVKAYLKEQEDLVGPKVDVENQ----AKGAEEI---
------------------------------------------------------------
----------------------ELTKRATDEVNAL-NVIELGDDDLNMSPDQLGFLRQAS
QIAPVADHHSSNVDLVSGSDIRRMESAGSSSSVGKNVPTFSNAEA---------------
--IERGMPFFNNLRVPWTLLFQASSEARREA--------------------------EGC
LSCVESRHKEY---REMLRYYDERKSDIARKMAMLESHPRHWLKNGFQLLAPMPDIILSY
CEDCARDAAAASKEKNPTIIADGDFIPRTPSLFY------LGPGATDADTNECQNFVNQY
FRTKKRRVDFRLEELETLIAKLKKKRRRVVIRLDE---V---------------------
------------------------------------------------------------
------------------------------------------------------------
----------------EQTIRALEIRS--------------EDWEKVGLQLMWPMPDR--
---------------LLQDNRVVSDRAI------------------------------
>gi|108708146|gb|ABF95941.1|	   775 residues, 50 /line  retrotransposon protein, putative, unclassified [Oryza sativa (japonica cultivar-group)]
------------------------MDLDKSTSTSTSLKKLQ----EDG------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------AL
PGRGTAER----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EVGGTE--P-QPVL-----GRMVVIEDFI-LC-
----GFLPPPSEFLLLVLN---FYSLSLLHLNPNSIA-FMSIFSHLCEAYIGVEPFLDLF
RFYYELSWME-------PKKV--SGCVGFRLRDGLK--SRYILFQC---PSSR--SKWRG
RWFYLQ--IE-----DSDPVFIVPEEQLDKISSWT----AKLA--LTPSLQSFIDIIDDL
RVRGLSG----YEVAADF---I--------------------------------------
------GLDS---ATVERRVGQLMITGPT-TASNVQ---VPLCEKGAAE-----------
--------------------RDVAINALPLTDIIGPLVDHQVA-------ASLKKKVAKE
VSD---------------------------------------------------------
-AVAAAATTS-----GGNVLKK-------------GRKFSSVVGHRRKTPTPSPVS----
------------------------------------------------------------
-----------------------V------------------------------------
-----------------------------------------AAFRRA-AWAKAAQDGSGG
TS--------------------------SASPIVASTDVVVVPRSREATPSGPASNL---
--ATGRGLPAAILTWEELQV-EMGCLLEAGARGIS------REIAEARAAAA------A-
------SANERADRLAHDLAEVREDLQKMRELVAGNKRQ-------RQGLEHRMSERENN
LSEIRGSLR-----------------------------------VTYTGLHQL-------
--------------------AGECGIKSTIPANPDEFSPTTSLAEL-----------ATA
MEEIPSKHAA--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------RIGEETSNGIYTGA--------------------------CHV
LACVRLAHPKL----DLRKILDQGAASDARKDVMEEVGDLGES------VLPLFEEDVDV
EDVQQRGQPELPVIVPALAFEPHVPEGDVAQNSP------VETSMATTPLDLESALADQD
RRIQYWRTKFEVAELERTMLEVKKDQAVETLRGRE---VWFNSYLKSFCTSMSRVCRELR
VPRGDPEKSAT---GYIPWL----NGACAQ----LEGIS-----------QRIDEALKQE
CRRSSQYAGGMYWP---------------------------------VYEIIVRSCTSSS
----------------SMKGFLVLGEL---------------LR----------------
---------------------------R------------------------------
>gi|108862434|gb|ABA97327.2|	   768 residues, 50 /line  retrotransposon protein, putative, unclassified [Oryza sativa (japonica cultivar-group)]
------------------------MDLGKSTSTSTSLKKLQ----EDG------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------AI
PGRGAMER----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EPGGTE--P-EPVL-----GRIVAIEDYI-LC-
----GFLPPPSEFLLLVLN---FYGLSLLHLNPNSIA-FLSIFSHLCEAYIGVEPFLDLF
RFYYELRWME-------STRV--SGCVGFRLRDGLK--SRYIPFQC---PSCH--SKWRA
RLFYLQ--IE-----DSDPIFVIPEEQPDKIPSWT----AKPA--LTPAFQSFIDAIDDL
RARGLSG----YEVATDF---ISRR-IQPLQVR--AHPAFDYSGPEDATWVSPR------
------GLSD---ATVERRVGQLMISGPT-TASDVP---MPLCDKEATK-----------
--------------------REAAINMSVLGNL--AIIASRAV-------ASLKESIARE
TPDV--------------------------------------------------------
-AVAAAATTS-----GGRVPKT-------------GRTFTSVLGSRRRASSPPVVD----
------------------------------------------------------------
-----------------------ASSPPPRRRKL--------------------------
-----------------------------------VTLGEKSAQARV-AQARAAQDKSEG
AS--------------------------GASPAATSTDVVVAPRSREVTPSGLSSAL---
--GPARGPSANVLTWGELQA-EMQRILEAGTCGVS------REIEEAKTAAA------S-
------SANERADKLERDLGEVHEDLQKMRELVAGNERQ-------RRGLEDRMSELENN
LSEIRGSLR-----------------------------------VTYTSLHQL-------
--------------------AGECGVTTTIPANPDEFSLTSSLAEL-----------ATA
MEAIPSKHAA--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------SIVEEASNGIYTGA--------------------------YHV
LACVRLAHPER----DLRQILDRGAANDARKGVMEE------------------------
-GCRCRGCPAAWAAQVT-----GGRPGDYPPNAC------VAGRYGTKLTRGN-------
------------------------------GRGDD-------------------LLRELR
VPRGDPEESAA---GYISWL----NGACTQ----LEGIG-----------KRIDEALKQE
CRRLSRYAGGHVLACIR--------------------DHRPQLHLEFLREGFAHSRRTSA
----------------EIDHLAKSMAP---------------LAEEVFQSMDWCWPS---
---------------------------W------------------------------
>gi|28927678|gb|AAO62324.1|	   799 residues, 50 /line  hypothetical protein [Oryza sativa (japonica cultivar-group)]
------------------------MDLGKSASTSAMLKKLR----EDG------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------AL
PGRGTIER----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EAGGTN--P-QPIL-----GRMVAIEDYV-LC-
----GFLPPPSEFLLLVLN---FYGLSLLHLNPNSIA-FLSIFVHLCEAYIGVEPFLDLF
RFYYELRWME-------SNRV--SGCVGFRLRDGLK--SRYIPFQC---PSSR--SKWRN
RWFYLE--IK-----DSNPVFVVPEDQPNKIPSWT----AKPP--LTPSLQSFIDIIDDL
RVRGLSG----YEVVADF---VGRR-IQPLQAQ--AHPAYNYSRPEDATRVSPR------
------GLSD---ETVECRVGQVMISGPT-TASDIP---VPLCEKGAAE-----------
--------------------RDEAINALPLTDIIGPLADHQVA-------SSLKVKVVKE
VSD---------------------------------------------------------
-----AATTS-----GGNVPTK-------------PRKFSYVSGQRHKASTPSASN----
------------------------------------------------------------
-----------------------ASPPPPRRQRI--------------------------
-----------------------------------VTIGEKE------ARAKAARAKSEG
AS--------------------------SASPVVASMDVVPAAGSREATPSGP-------
---------------EELQV-EMGRLLEAGARGIG------REIAEARSEAA--------
------TANARADRLVRELAEAREDLTKMRELAAGNERQ-------RKGLEDRMSELGNN
LSEIRGSLR-----------------------------------VIYTGLHQL-------
--------------------AREYGVTSTIPANPDEFSLTSSLAKL-----------ATA
MGEIPSKHAA--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------RIAEETSNGIYTGA--------------------------CHV
LTCVSLLRPEL----NLREILDQGAASDTRKEVMEEVGDLGES-----------------
-----RGQPESLAVILVLEFEPHVSPDHVDQPLD------IEGRMATTSSDLEGALASQD
RRIQYWKTKFEVAELERTMLAVKKEQAVETLRGRE---VWFNSYLKSCYTSMARVCRELR
VVCGDPEESAA---GYISWL----NGACAQ----LDGIS-----------KRIDEALKQE
CPRSSRYARGHVLACLR--------------------DHRPHLDLEYLREGFARSRRTPT
----------------EIDHLARSMSL---------------LAEKIFQSMDWC------
----------------------------------------------------------
>gi|38346004|emb|CAE01887.2|	   800 residues, 50 /line  OSJNBa0035O13.6 [Oryza sativa (japonica cultivar-group)]
------------------------MDLGKSASTSATLKKLQ----EDG------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------AL
PGREKAER----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EAGGTN--P-QPLL-----GRMVAIEDYV-VC-
----GFLPPPSEFLLLVFN---FYGLSLLHLNPNSIA-FLSVFVHLYEAYIGVEPFLDLF
RFYYELRWME-------SNRV--SGCVGFRLRDGMK--SRYVPFQC---PSSR--SKWRN
RWFYLE--VK-----DSDPVLVVPEEQPDKIPVWT----AKPP--LTPSLESFIDIIDDL
RERGLSG----YEVVADF---VGRR-IQPLQAR--AHPAYNYSGADDATRVSPR------
------GLSG---EVVGRRVSQVMISGPT-TASDIP---APLCEREAAE-----------
--------------------RDEAIN---------------VA-------ASLKEKVIQE
ASD---------------------------------------------------------
-----AATTS-----GGKAPTK-------------TRKFSSVLGNRRKAETPLASD----
------------------------------------------------------------
-----------------------VSPPPARRQRI--------------------------
-----------------------------------VTIREKE------ARSKAARGKSGE
TS--------------------------GASPVTASTDVVPVVGSREATPNGPVGDP---
--VEGCGLSEAVLTWEERHV-EMRRLLKAGACGVG------REVSEARAETA--------
------AANARAELLVRELAEAREDLTKMRELVAGNERQ-------RKGLEDRMSELGDN
LSEIRGSLR-----------------------------------VTYTGLHQL-------
--------------------AEECGVKSSIPANPDEFSLTSSLAEL-----------ATA
MGEIPSRHVA--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------RIAEETSNGIYTGA--------------------------CHV
LACVKLSCPEL----DLREILDQGAASDARKEVMEEVGDLGE--------------DADD
EDVRQRGQPESLAIIPVLEFELHASHDVEDQTPD------AEVEVTTTASNLEDALATQN
RRIQYWKTKFEVAELERAMLAVKNEKAVETLRGRE---VWFSSYLQSCCTTMAR------
-------ESAA---GYISWL----NGACAQ----LNGIG-----------KRIDEALKQE
CRRASRYAGGHMLACLR--------------------DHRPRLDLEFLREGFLHSRRNPA
----------------EIDHLARSMSP---------------LAEKIFQSMDWRWPS---
---------------------------W------------------------------
>gi|77551184|gb|ABA93981.1|	   839 residues, 50 /line  retrotransposon protein, putative, unclassified [Oryza sativa (japonica cultivar-group)]
------------------------MDLGKSSSTSASLKKLQ----KDG------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------AL
PGRGTMER----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EAGVTD--P-QPVL-----GRMVAVEDYI-LH-
----GFLPPPSEFLLLVLN---FYGLSLLHLNPNSIA-FLSIFSHLCEAYIGVEPFLDLF
RFYYELRWME-------SNRV--SGCVGFRLRDGLK--SRYIPFQC---PSSH--SKWWT
RWFYLQ--IE-----DSDPVFVVPEEQSDKISSWT----AKPP--LTPSLQSFIDIVDDL
RVRGLSG----YEVTADF---VGRQ-IQPLQAR--VHPAFYYSGPEDTTRVSPR------
------GLNS---ETVGRRVSQVMINGPT-TASNIP---VPLCEKGAAE-----------
--------------------RDTAINALPLTDIIGPLADHQVA-------ASLKEKVTKE
ASD---------------------------------------------------------
-A-AAVATTS-----GGNVPTK-------------GRKFSSISGHRRKASTPSASD----
------------------------------------------------------------
-----------------------ESPPPPRRQQL--------------------------
-----------------------------------VTLGEKA------ARAKAVQDESGG
TS--------------------------GASPAVASTDVVLAPGSREATPSGPASDL---
--AAGRGPPAAVLTWEELQV-EMGRLLEAGARGIG------REMAEARSAAA--------
------STNERDDRLAHELAEAREDLKKMRELVAGNERQ-------RQGLEHRMSELGNN
LSEIRGSLR-----------------------------------VTYTGLHQL-------
--------------------AGECGFKSTIPANPDEFSLTSSLAEL-----------AAA
MEEIPSKHAA--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------RIGEETSNGIYTGA--------------------------CHV
LACVRLAHPEL----DLREILDQGAASDTRKEVMEEVGDLGES------VLPLFEEDVDD
EDVQQRRQPESPAIIPALAFEPHASPDNVDQILA------TGTGMATTSLDLESALAGQD
RRIQYCKTKFEVVELERTMLAVKKEQAVETLRGHE---VWFNSYLKSCCTSMAKVCKELR
VPRGDPEGSAA---GYISWL----NGACAQ----LDGIG-----------KRIDEALKQE
CHRSSRYAGGHVLACLR--------------------DHRPCLDLDFLREGFARSRRTPT
----------------EIDHLARSMAP---------------LAEKVFQSMDWRWPS---
---------------------------W------------------------------
>gi|11358458|pir||T51428	   757 residues, 50 /line  hypothetical protein T9L3_130 - Arabidopsis thaliana
MGKVV-------------------LVSPSSSSSESEASLVR----RNS------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------RL
TGNPSDEAQSSRSN--RIEIPTLLDEPDRE----G-------------------------
---------SGGHLAAPEDPADFLAQF---DPLIDLED-----AYNTQPQYTEAE-----
------------------------------------------DHVEFDVDSVVSWNTEIA
A--------------------------------------------------------KKT
LSTTESVAEVFALCGSGDRPL--TYMIPGENER--PWNPPR-----GYVCMYEAYFRQC-
----HLWFPIPSLIISFLN---RRRMAFSQLTPAAICSFVAALTFGAE-----EGYLVNV
RCFEEMTTLK-------AIRS--PGY--WLVNNRPK--HNFLPGEE---KDVD--GIDTG
-----------------------------------------------------------L
VRIFIA------------------------------------------------------
------------------DGDFIPRTPSLFYLGPAA---TDADTTECQNFVNQ------G
LLWFVG---------FLHQDQCRELQYFR-TKKRRV------------------------
------------------------------------------------------------
DFCLEELETL----------------------------IAKLKKKRRRVVTRLDEV----
------------------------------------------------------------
-----------------------EQTIRALDIRS--------------------------
-----------------------------------EDWEKAACAGRE-TSLGLCPAGLYA
GLGL-----------------LPVEHLFGRSRNGSAYVSVRTRAYVSGRKGEL-------
----------------ECGK-KRRTRVWEAKANSS------VGSIGELECGK--------
------QRRSRVWEAKAISSVGSKEQ---------EKET-------MAPQTSGAVADQTS
TSELESQTP-----------------------------------DLYLQTTALE------
---IRMEKIDKDMEWFKAAMGNLLRGQVFGEDRERTPACFASPISV----SGGIQQT---
------------------------------------------------------------
----------------------PGTPDTVADKNPRPGSLPLANPEPNQRP------AEGL
LPTPPAQQRLEFVGLTTETQFKPID-----------LPEYEETQK---------------
--LEQAITALTGTAINWWQIAQYPEK----------------------------------
----ISTWKDF---RDKFKVRFKPARGAATIDQLFTIFQRGSVEEYRNRFEEIAVELPHV
TDDVLESAFLNGVEFVDTIIE-KTMLDVCPSSCQ------FISDVLSDDVNFA-------
--------------------------------------V---------------------
------------------------------------------------------------
------------------------------------------------------------
----------------VESLAFLQFA----------------------------------
----------------------------------------------------------
>gi|15232832|ref|NP_187621.1|	   1004 residues, 50 /line  filament protein-related [Arabidopsis thaliana]
MGKVV-------------------LVSP-SSSSESEMPLVR----QTS------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------RL
TGNPNDEAQSSRSN--RIEIPTLLDEPDRE----G-------------------------
---------SGGHLAAPEDPVDFLSQF---DPLIDLED-----AYNTQPQYTEAEVNARL
LHE---------------------------------------DYVEFDLDPVVSWNTEIT
A--------------------------------------------------------KKT
LSTTESVAEVFALCGYGDRPL--TCMIPGEEER--PWNPPR-----GYVCMYEAYFRQC-
----HLWFPIPSLIISFLN---RRRMAFSQLTPAAICNFVAALTFGAE-----EGYLVNV
RCFEEMTTLK-------AVRS--PGY--WVVNNRPK--HNFLPGPK---VSNF--KNWEE
YYFYVR--VD-----LE----SYERPFSGRKRTWT----EFPD-RYRPSPEFPVEFEGVL
EAIFRAR----RRAWKDI---TRSR-VNRIMGK--VRKSFVSFAAGLLNMPPPP------
------ASIE---ETQPLDGEAAALNPPV-SAGPSG---VDQVSQETGNPDSQ------D
KTCLEGAEVIPAQ-EIAECEQSQSVQVVE-PEVRNVTGDRSVV-------VYAAAPESEE
VNTG------------------------------------------------LTILDQDK
GEKVAELGAS-----RRSREEK-------------GKGLASQSKKRSASEAGLDEA----
------------------------------------------------------------
-----------------------AAPKTFRLSRG--------------------------
-----------------------------------ETLNSDQFTFKY-SGEKFLVRDQEA
ASHL-----------------WRNLMLPGAADFPNPDDLVLKEGYQKFARSSL-------
----------------ETAA-LANDLIATYDRKLK------L-KLADREAFD--------
------NLKKCADQAKAIYAKDMKEMAALRDAAEIHKAE-------MSSLNDEVKRLNGR
EANLQKEIS-----------------------------------DLQVALVAVKEHGERE
CNRLRNDRATKVARTTKKAQARLDKVKAYLKEQEDLVGPKVDAENQ----AKGAEEIVGI
LMQRGAKIAA----------SEL----------SGLK-----------------------
----------------------ELTRRAADEVNAL-NVIELGDDDLNMSPDQLGFSRQTS
QVAPVADQHGSNVDLVSGSDIRRMESVGSSSFVGKNVPTFPNAEAW-------------N
RKIERGMPFFNNLRVPWTLLFQASSKERREA--------------------------EGF
LSCVQSRHKEY---REMLRYYDERKSDIARKMAMLESHPRHWLKNGFQLLAPMPDILLSY
CEDCDRDAAAASKEKNPTIIADGDF--RTPSLFY------LGPAATDADTTECQNFVNQN
FVALISQVGFLHQDQCRELQYFRTKKR---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------SGFSSRGARS--------------SD-----------------
---------------------------C------------------------------
>gi|121716270|ref|XP_001275744.1|	   1199 residues, 50 /line  chromosome segregation protein SudA, putative [Aspergillus clavatus NRRL 1]
MYVKQ-II----------------IQGFKSYKDQTVIEPFS---PKHN----VIVGRNGS
GKSNFFAAIRFVLSDAYTHLGREERQALLHEGSGSAVMSAYVEIIFDNSDDRFPTGK---
--------------PEVVLR----------------------------------------
----------------------------------------------------------RT
IGLKKDEYTLDRKNATKSDVMNLLESAGFS----R-------------------------
---------SNPYYIVPQGRVTALTNMKDTERLTLLKE-----VAGTQVYEARRAESLKI
MHE--------------------TNNKKAKIDELLDFINERLAELEEEKDELRNFQEKDK
E--------------------------------------------------------RRC
LEYTIHSREQQEISSILDNLE--EQRQTGVEDT--DLNRDRFIEGEKEMAQIDAEIAEC-
----KQQIEFLKVDKSQLE---DERRETSK-TLAQVELRAKSLSDNQV-----ATQALKA
RHDQELEAVQ-------S------------------------------------------
------------------AIKERETELQDLIPRFN----AAKE--REDDIKSQLSEAETT
RQRLYAK----QGRNSRF---RNKS-ERDKWLQ--TEIKENYTSISTVQAVMAQTQEDIK
ELENDIALLE---PETERLRQQIDGRGDTVHSVEQQ---VQAAKDERDRLMDQRKELWRE
EAKLDSILSNASN-EVDRAERTLSQMMDH-NTSRGIAAVRRIKRQHNLEGVYGTLAELFE
VNDR--------------------------------YRTAVEVTAGQSLFHYVVDTDETA
TKVLEILQ-----------QDK-------------AGRVTFMPLNRLRSRAANLPR----
------------------------------------------------------------
-----------------------ASDTIPMIDKL--------------------------
-------------------------QYDPAYEKAFQHVFGKTIICPN-LQVASQYARSHG
VN--------------------------AITPEGDRSD------KRGALTGGFHDSR---
--QSRLDGVRNLTKW--------------------------------RDEYE--------
------SKKNRGT-------EIRRELEKLDQIITKAVGE-------LQKLEQQRHQVQNS
SGPLRQELR--------------SKRDLLQKKNDNLDAKRKALRNIETNLAAL-------
--------------------NDQVNAFEAELKSPFQKALTNEEEAQLESLSAVAQDLRQQ
YHELSAQRSELEARKSILEVELR----------ENLNPHLDQLFSRDVDMVDDDGQGNLK
ETE--REMKRLRKTLENLSQRLQQVDESIEKANSQVTELEQQKAE---------IRRELE
ELARSIEKHQRRMEKNMQKKAALTKRAAECAANIRDLGVLPDEAFTKYKHTDSNTVVKKL
HKANEALKKYSHVNKKAFEQYNSFTRQRETL--------------------------TSR
REELEASQKSI---EDLISVLDQRKDEAIERTFKQVSREFA---NIFEKLVPAGRGRLII
QRKTD------------------------------------------RPLRRDEDMDSDD
ERAQQSVENYVGVGI---------------------------------------------
--------------------------------------------------SVSFNSKHDE
QQRIQQLSGGQKSLCALALVFAIQAC-----------DPAPFYLFDEIDANLDAQYRTAV
AQMLQSISESTNGQF-ICTTFRPEMLHVAEKCYGVSFRQKASTIDVVSREEAL-------
--------------------KFVEEQKT------------------------------
>gi|83769495|dbj|BAE59630.1|	   1199 residues, 50 /line  unnamed protein product [Aspergillus oryzae]
MYVKQ-II----------------IQGFKSYKDQTVIEPFS---PKHN----VIVGRNGS
GKSNFFAAIRFVLGDAYTHMGREERQALLHEGSGSAVMSAYVEIIFDNSDDRFPTGK---
--------------PEVVLR----------------------------------------
----------------------------------------------------------RT
IGMKKDEYTLDRKNATKNDVMNLLESAGFS----R-------------------------
---------SNPYYIVPQGRVTALTNMKDSERLNLLKE-----VAGTQVYEARRAESLKI
MHE--------------------TNNKRTKIDELLDFINERLSELEEEKDELRNFQEKDK
E--------------------------------------------------------RRC
LEYTIYSREQQEISSYLDSLE--EQRQTGVEDT--DLNRDRFIQGEKEMTQIDAEIAEC-
----KQQIEFLKVDKAQLE---DERREASK-ALAQVELQAKSLTDNQA-----AAQAQKS
RRDEELKSVQ-------A------------------------------------------
------------------AIEEREAELQQLIPSFN----SAKD--QEDAVKAQLTEAETS
RRRLYAK----QSRNSRF---RNKS-ERDKWLQ--AEIKDNYTSISTVQGVMAQTQEDIK
ELENEIALLE---PETERLRKQIDGRGDTIQSVEQQ---VQAAKDERDRLMDQRKELWRE
EAKLDSILVNATN-EVDRADRSLSQMMDH-NTSRGIAAVRRIKRQYNLEGVYGTLAELFD
VNDR--------------------------------YRTAVEVTAGQSLFHYVVDTDETA
TKVLEILQ-----------QEK-------------AGRVTFMPLNRLRSRPTNMPR----
------------------------------------------------------------
-----------------------ASDTIPMIEKL--------------------------
-------------------------QYDRAYEKAFVHVFGKTIICPN-LQVAAQYARSHG
VN--------------------------AITPEGDRSD------KRGALTGGFHDSR---
--QSRLDAVKNLTKW--------------------------------RDEVE--------
------TKKSRGN-------EIRKELEHLDQLITRAVGE-------LQKLEQQRHQVQNS
SGPLRQELR--------------SKRDLIQKKNDNLEAKRRALRNIETNLAAV-------
--------------------TDQVNAFEAELKSPFQKALTNDEEARLESLSATAQDLRRQ
YQELSSQRSELEARKSVLEVELR----------ENLNPRLDQLVGQDIDMADDGSQGNLK
ETQ--REMKRLSKALEKLGQRLQQVDESIEQANARMAELGQRNAE---------TRRELD
ELAKSIEKHQRRMEKSMQKKAALTKQAAECAANIRDLGVLPDEAFTKYKNMDSNAVVKKL
HKVNEGLKKYSHVNKKAFEQYNSFTKQRETL--------------------------TNR
REELDASQKSI---DDLINVLDQRKDEAIERTFKQVSREFH---NVFEKLVPAGRGRLII
QRKTD------------------------------------------RAMRQADELDSED
EEARNSVENYVGVGI---------------------------------------------
--------------------------------------------------SVSFNSKHDE
QQRIQQLSGGQKSLCALALVFAIQAC-----------DPAPFYLFDEIDANLDAQYRTAV
AQMLQSISDATNGQF-ICTTFRPEMLHVAEKCYGVSFRQKASTIDVVSREEAL-------
--------------------KFVEEQKS------------------------------
>gi|15217933|ref|NP_173465.1|	   944 residues, 50 /line  myosin heavy chain-related [Arabidopsis thaliana]
------------------------MESAVQVNGFHPHREIT----SQG------------
-GVNGCVNARIKQVRGATRRCRFELVVLVSWLFWASWLIFDEQTSLDELTCIDELAL---
--------------PGELTCAILSPGPEKRPFSRDFLFLIYTRPYSRVRKISETDAPVAS
SFS--------------------------MQRVDPTCLLIRALGFLRIRKLKRSLSDHRR
SRTPDGSSERSGAD--RFRAESLDDDLVEA----GYS-----------------------
---------SSGSSSRTSVVAELRRRI--SSPLVDRAETGAAATTTFKPRLTDEEIGDED
FKEAIASEEIAIFEPRSAVG--GGFGDDVKEMTVSDEI------GVFPGVSGPKPGSADY
L--------------------------------------------------------GPT
KTSASSMSTALRFCN-APRGL--VARVPETHER--PWTTPE-----GYMCVYEKFLTEC-
----GLSFPIPIFLLGFVA---RRKMALSQLTVAAIRYAVGLIRLAEQ-----CGVEVRR
SHYEEVINLK-------RIGSARPGF--YYAQSATK--PKIITGV----KSKT--NDWCF
EYFFVK--VT-----KE----SVGDHEMVDLSEWR----MTPVRRLKILDPFPEELKEDL
LKIRAVS----PYVWPTG----EEK-ERLSLHK--PKKARKTPAKRKMKMNTEEVGS---
-----------------------------------------------------------Y
SSRYKRQKTSALK-ESQEKDHLPSGE------DRAARSVEEERRTARSEPPRG-------
------------------------------------HQGRSVVNP-------GSSVDRSK
ETREKELATA-----RQGKQLE-------------G------------------SA----
------------------------------------------------------------
-----------------------RSDVPPGCNTL--------------------------
-------------------------IVHPG-------PANDPHRRRS-SGAIEEIRSDAR
VSKQ---------------PDYRWEHYYSGR---EVKELKEMKAFTDVARKTL-------
----------------DAVG-SMNRLAYLYERRFRN-MEV-LGSQDLRGELS--------
------AEKKKNDELLKKLESASKEAAHLKSEVATLAYQ-------RTVMGEERDRCTLD
LEKEREKTV------------------------------------------ELEDRLKSE
KKRLRSRREKYAENQTSKAL----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------IHVADLFQARMNRVKAHLDDKLKINPKFLDYNQVCGNV
A-----------------------------------------------------------
---------------------------------------------LLDEL----------
------------------------------------------------------------
------------------------------------------------------------
VEAGEIEIKST---ELMPRLIADRDALKAE----VEGFEITEIEKDDFDVWTLFEKVLEE
EHFEPSASGGH----------------------------------SETEAE---------
--------------------------KDEETSVEDASQRKPETPGP--------------
----------------LPDDPAAAPVPE------------------------------
>gi|15222544|ref|NP_174481.1|	   835 residues, 50 /line  myosin heavy chain-related [Arabidopsis thaliana]
MGF--------------------------SSPNNSVASYIR------------------E
RTPSDLSGKKSPSIGWSEESSRRSVGSSTHRGNSAEVPSSGID-----------------
------------------------------------------------------------
---------------------------------------------------------RRE
ISAIRDRVPSSSRV--PTVVPCLRVNTDSD----G-------------------------
---------AGNRYADDE------------------------------------------
-----------------------------------------RESADENVSGESRKNEMVD
L--------------------------------------------------------GPT
TSTRESVGQTTDFCL-LPGPL--TIRIPRDTDR--PSDCPE-----GFICLFEGFFTET-
----GLRFPIPDFLMRFCR---NRQIAISQLTVASIRTAACLQMLCAR-----CGIPLSV
ELMEELTSFS-------KVP-HKLGQ--HYISSVRG--FKILE-NG---PSKT--RDWLG
GYFYAK--VD-----RN----LVEDPSVEFRIEWN----LDYAPNLRILRNCSRRILDQA
ETLREQA----PIDW------------KQVPCL--KHKKQNKRKPQKSSARPKKMSGENV
NLATL------------------------------------------------------M
REKRARKEAESKA-RLAIVDKTHEDKARLDVAEKNRKGLEDK-------TKKGTFGAERR
DVTD------------------------------------------------VTRVDKAR
PITVGQKGSS-----GRSVDRE-------------RSGLDTSG-SKRPCSSKEVVP----
------------------------------------------------------------
-----------------------ALDKRRRIGSG--------------------------
-----------------------DVDLSAGPRLLANADHSFRYEYKV-RDSPFSADRVEC
ARFL-----------------RKVVGAPGE---PEHEFLAEADLFEKWARAEC-------
----------------QAVG-ANNLLISRYDRNLRS-ARE--------------------
----------KILELEGKLKNAERTIAYNNQQA---------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------K
ADF--EELKALKKKIVVLKAERSKEAATLENVLRQQTLLEARLAE---------------
-EKEIFRRFREEKFAEDMEKTRAELLNKYYERSEKIFRHIAETENASHMVKMHAQATGTL
SCLKF-------------------------------------------------------
----LADEDKI---PIPASTFEEFEDEAKE------------------------------
-----------------------------------------------------------W
KDKIDAFVVTELVNGGSVITPVAPHGSTENVLGSEESPFWINQFGSNLGVLAACEIDPIT
EFFTDPKLAA------------------LV----SAGV----------------------
------------------------------------------------------------
KKAIVTISDDEPAAV-ITTEDGPVPASHAE------------TAPTIGDSSVL-------
--------------------ASNAE--P------------------------------
>gi|15226513|ref|NP_179144.1|	   957 residues, 50 /line  myosin heavy chain-related [Arabidopsis thaliana]
---------------------------MPVRREQQVFLLFT---RK---------ALCFK
IGVSFLQTLAVGFVLRKGEPPNMAAERTGELEFGLEEVVVPERAEEAPTVGISPINREAV
GELGGHIARHNGFGEGEVARTEFGPSCETVERSR--GEFDVRFLAGELVDGDGDELVGVA
GENGIVGEELGVCSNGGELSGGDGEINGEREELGGEREGLVGCEGEIGVRRVDVAV----
--RPSGETSRERPN--GDVLEPSVHETRRERDKCGNNGQGELSKMGDPLQRDVLGASRVA
SAPSPARFGKGKNLDAILN-AEF-GGF---DPMDDRDFG----GFNDFGEEVSYVYDCEN
VDE------DYISDPEGELGENGGLGRL---------------MMENGFDNLVVSGRDTG
ARGAVGTRPVSRIEERRTGDCSAVRGRQIVLG---------LRASYFERVVAPL-DHGSS
LCDDQSLADMLILCN-APREI--ELLKPDSLQR--PWTPPE-----GYICLYEAYFTRC-
----GLLFPLPNFLTEYCA---RRNIAISQLTVGAIRNAIGLAILGAE-----CGIEIDT
DFFEEATTFS-------RVK-ESPGS--YYASAKAK--HKIVSG-A---VSKI--HGWKR
RYFFVK--LS-----EF----SVENLDTVFVDDWT----MSP-EPVFRVRDFPPGFLDNI
ARIRELG----ALHWPTGSFPETRQ-TRPRMGK--IIPQL--------------------
---------------------------------PRF---VDEFGE--------------N
PDLMNGVEPSPVV-TEARLDVEN-------------RGDESLG-----------RGSATE
SATG------------------------------------------------DVVVDRSE
KRPVAEDKGTDGDVVHRSALPS-------------LGGSTPSKKRTSRDDAEKGSF----
------------------------------------------------------------
-----------------------KVPKTPRRETT--------------------------
--------------------------------VRGAVDHGFSYQYKA-KDIAFTQNATSC
ADLV-----------------SRIRGAS--DDFSSVDRFVERELFKDWAQKTC-------
----------------QSIG-AGNRLSSFLGCKAKV-S-------ATRLATE--------
------SAECEA------LQKLAKELAVERERSATLEKR-------SSELFEQVSS----
--------------------------------------LQSSVDETRMQLEALDKRFASE
GARLRKSRIEHVAAERKKSD----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------SQVTGTL
QCLEK-------------------------------------------------------
-----LVKKKV---AIPPATIRE-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------LEVRERTLDNG----VRQLEVADLLPGDLD-----------
------------------------------------------------------------
-----------------------------------------PFEEVEAGAVGAALVSG--
--------------------------IS------------------------------
>gi|15231483|ref|NP_189705.1|	   791 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------MSDFEDSQNKSNHNYGDDESS-------
------------------------------------------------------------
------------SETRSAASPQRVQRRVITLGGIGPIRPPSIRADKPKKKKAAK-QGGGT
RMTNSDLVDLRRRCQ-VPVGV--TMILPRPPLH--RENVPV-----GWCCAYANFFEK--
--------------------------YMPELCPPC----IGVIHPARE-----VDREFNC
HDLLQLCQVK-------TNARSDQGT--YYISARPG--SLILGGLK---AYRD--TNWRS
KYFLFR--TN-----WA----TFSRDRIVAAHAVASVVPLAPAVPAIVLPAAQLDPIEET
-----MYGLLRQLLPPDS---SSTS-ELPLIRR-MRRPSLRVQRANAGAPARGD------
------DLST---AMTAARHTLAVSSASA-------------------------------
---------------------------------------------------SASHPSIPE
INTG------------------------------------------------ASAVAG--
---------------------R-------------SDC--APSSPKRAWTQPE-------
------------------------------------------------------------
------------------------GVASPREERIESAAAIPDAAASADRRSSGRSHGGGR
-GSRGGGRSSNRTQ---------KVRQTSNSGGGSAGSGPFHWSNTHDRDHPIVDDEAGL
ANLL-----------------RHIKGRN--CQVPGVKNMAKAASYADMMAKEG-------
----------------QAIA-ATNKLVALYEQRLSQ-VPSASELEEGKTLIRELTSSVK-
------AGQEREVSFQAEIERLKIELSTSKDLEKGYAAK-------IGLMEMEIGG----
---LQADKQ--------------MARNQIHRLEQRREQLSKKVM-------DLTSTAQGA
KKAV-HDAKVELAAAYSKLLAG----IKEKWVSKKEYTMLEGQAVE--------------
-------------------------EVSDFTLSKLDLPQVSEI-----------------
------------------------------------SVVRLMDVDEQGTPIGLDEFESNK
DAFPGGLAEGSGT-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------VFATPAGESRLNALEGFY---PFVYCFLNLVPGKAFILC----
---------SF---KYLDAW----EGTCQI----LGAGL---------------------
-------------------------------------------------------VVSSD
EAEVMCSYKSSSLSTFWKQDHKIDPPTFGCWALGIVSSKSSLMEDVMSVSFVE-------
--------------------VSSFKWKG------------------------------
>gi|22328470|ref|NP_680652.1|	   764 residues, 50 /line  myosin heavy chain-related [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------MSDFEDSQNKSNHCYSDDSSS-------
------------------------------------------------------------
------------SETRSAASPPRVQRRALTLGGMGLIRPPSTRADKPKKKKVAK-QGGGT
PMMNNDLVDLWRRCQ-VPVEV--HMILPRPPLH--PENVPV-----GWCCAYANFFEKY-
----GLFFPIPACILEMLY---CLGLAFPQMCPNFVCHVLALFTRARE-----VNRKFSC
HDLLQLCQVK-------TNARSDQGT--YYISARPG--SLVLGARTKEVTLSE--TELEL
LTLLQRGQTN-----WS----TFSRNRIIAALVVAPAVPVAPAVPAIVPPAAPLDLIKEV
PRIEPVPEADLPIVPPDS---NSTS-ELPLVRR-MRRPSLRVQGANAGAPARAG------
------DLSA---AVTAARNTLAVSSASA-------------------------------
---------------------------------------------------LASHPSLPE
VNIG------------------------------------------------TSAAAGQP
DNN------QVAHVSRPSEVVR-------------PDG--APSSPKRARTQPEVNP----
-----------------------------------------------------------A
AELVVSD----------------QRVASPREERMEPAAATPEAAASAARRSSGRSHGGGR
-GSRGGGRSSNRSQ---------EVRQTSNSGGGSAGSRPFHWSYNHDRDHPIVEDEAGL
ANLL-----------------RHIIGRN--CQVPGVKNIAEAAAYADMMAKEG-------
----------------QAIA-ATNKLVALYEQRLSQ-VPSANELEEGKALIRELTSSVK-
------AGQDRKVSFQAEIERLKMELSTSKDLEKGFAEK-------IGFMEMEIRG----
------------------------------------EELSKKVV-------DLTSVAQGE
KKAV-HDAKVELAAAYSKLLAG----IKEKWVAKKECTVLEGQTAEVESNLALIDQITKA
AIDLNMERPRLQAEKDDLEARCKSKEVSDFTLSKLDLPQVSEI-----------------
------------------------------------SVVRPMDVDEQGTPIGLDEFGSNK
DAFPRGLAEGSGT-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------VFATPAGESRE--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------
>gi|42566327|ref|NP_192496.2|	   818 residues, 50 /line  unknown protein [Arabidopsis thaliana]
MWTAE-------------------MERLFSAPHL------------------TVQIRREE
GISAISKIVVMMALNNFPPLHLTSRRKI---------------------------SSFFF
------------------------------------------------------------
------------------------------------------------------------
----------LLLSPSFLFYSLLLDLPSLL------------------------------
---------------FSFISLVLLCRN---RKMIDFEDSQNKSNHSYDNDEIS-------
------------------------------------------------------------
------------FETRSAALPPRVQRRVITLGRMGPIRLPSTRADKAKKKKAAK-QGGGT
PMTNSDLVDLRRRCQ-VLVEV--NMILPRLPLH--PENMSV-----GWCCAYANFFEKC-
----GLFFLIPVCILEMLY---CLGLAFPQMCPNFVRHVQALFTRARE-----VNREFSC
HDLLQLCQVK-------TNARRDQGT--YYINARPG--SLVLVGLK---ACRD--TNWRS
KYFFFR--VD-----SR----T----KEVT-----------------------LSETELE
-----LLTLLRR-VPPNS---SSTS-ELSLIRR-MRRPSLRVQRANAGAPACAG------
------DLSA---AVTAARNNLAVSSASA-------------------------------
---------------------------------------------------SASHPSLPE
INTG------------------------------------------------TSAAAGQS
DNN------Q---VSGSSAVVR-------------SDG--VPSSPKRARTQTERGE----
-----------------------------------------------------------D
----------------------------------GTYGCYSGAAASADRRSSGRSHGGGR
-GSRGGGRSSNRSQ---------EVRQTSNSGGGSAGRRPFHWSYTHDRDHLIVEDEAGL
ANLL-----------------WHIKGRN--CQVPGVKNMAE-------------------
-------------------------------------VPSVSELEEGKTLNRELALSVK-
------AGQDREVSFQAEIERLKMELSTSKDLEKGYAEK-------IGLMEMEIGG----
---LQADKQ--------------TARKQIHRLEQRREELSKEVM-------DLTSTALGA
KKAV-HDAKVELAAAYSKLLAG----IKEKWVAKKEYTVLEGQAAEVESNLALIDQITKV
AIDLTVEKPRLQAEMDELEARCKSKEVSDFTLSKLDLPQVSEI-----------------
------------------------------------SVVRPMDVDEQGTPIGLDEFGSNK
DAFPGGLAEGSGT-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------VFTTP---------DSLF---VLGFCVL---------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------FQTWCLGRLLSFRLLLFELGA------------
-------------------------WEGFYLLF------------------------V
>gi|22773234|gb|AAN06840.1|	   904 residues, 50 /line  Putative membrane-associated protein [Oryza sativa (japonica cultivar-group)]
------------------------MARGSAPLEGSVLPPSRIVSERQAGLPRRFMPES--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------A
TGREVVA-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------LGEGR--PAPHYP-----GRSVFFLSFA-MA-
----GLVPPFSSFFMDVLE---LYDLQMAHLTPNAVM-TLAIFVHLCEMFIGVRPSLRLF
RWFFTVQPVS-------PPSV--VGGCYFQPRGPVL--NRYIPCVL---RKKW--DDWKS
DWFYTP--LA-----D-EARLRLPSQPPAQASSWR----APVD--LGDGYDAVLDRLAGL
RSQGLTG----AMVYGDY---LRRR-IAPLQRR--ARGAWEYTGSEDYMRTHQG------
------VKWDWVPEDIKVVIQRVLNLSSV-EASLIPQGVLPLCSDPE-------------
--------------------RANILTIMQAVGASGERAP-----RGHDGAGGSRRGEQST
PGG---------------------------------------------------------
-----------GRASGPRVGGP------------GGSRPADARGKRKQEDTPSPS-----
------------------------------------------------------------
-------------------------PPRGGRAAEEAVWEEAR---LRRAEESVRETEAAH
-ARRAACQAPDPTP--------PEATTTSEATHDEAAGAPLGPDPSGDVRDEPASGDAPE
FGT-------------------SIGGPSRAAPTPRRLSPLPSAASLSAEPL---------
------------------------------------------------------------
----------------------------LQALAAANTTV-------LDGLSAQMEVLQAE
RAEVDAAWARVEEGRRSVEAMVEAGRKAHRRHASELEARRRVLAEIAREVEEERETALIA
TAVFNAA-------------RDDLCLQYGSRAVELEKKLDASRQR-EEALEARATVLEKR
ACALDTKERELAGREAAVAIR------------------EATLAAHEAACAEEESALRLR
EDELTERERALEEAEAAAQLREEKARLNLEGARAERAALDQRAAE---------FEARAK
ELDARARS----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------GGAATGDGD
LAARLATAEHTIAELQGALDSSAGE--VEALRLMG---EVGPGMLRDAVSRLDRAGRQAG
LWGGRTAKYAANQGGLAQRL----SEMAGT----LQRLP-----------EELEETIKSS
SRDLARGAVELVLASYQ-------ARDP---------DFSPWAALDEFPPGTEDGARAQV
RDA--------------ADHIVHSFEG---------------TAPRLAFALDSDEEGG--
---------------DGGADDSDDEAGDPGAS-------------------------A
>gi|23616953|dbj|BAC20656.1|	   965 residues, 50 /line  hypothetical protein [Oryza sativa (japonica cultivar-group)]
MGKNK-KTAEKSKSKKSKSHEDTSCGIGASSIKEKNLNDLV----DVG------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------WI
SGRNVVIR----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------PVGESR--P-SPKL-----GYTLVFEDFF-YA-
----GFKFPCSTFLVEVLK---LFRLEFPQLTPNALV-RIGLFEWMIRSCGGTPRAEDFA
YFHCTRHYTK-------QNSK--FGCVNFAPHPKRG--SPWPAVSA---IRAKWGNKWQS
KWFYHQ--IPLSLLNDKDCPFSFSGKKPKTVSE------PSVS--LSPEFTAIQPRIEEL
V-SKFSC----RDLVEEF---VLLK-IRPLSS----------------------------
--------------GWDITLGEIPENCPS-SLPPFVVSS---DRKFPEDM----------
--------------------------VRPVRKFLGPYTKDEHL-------KFLTLQNEKR
QNRVFASLGSDIPVRVHPEIVPKLKKKKSVKPSSSDDDDDVEVEDIDEEIGEENAEEEEG
EEGADEEENDSGDDSDSSSSSSDNSSDLSESGDSKTVPPPTVLADLKRKKTASSPPPEPS
SKRVQLVIDSDEELDEDDIRIDLSAIH--VTPIRADASFALSAKEV-----ASLYVVAPT
TTVVEKDCSTQVGDTV------ETTNPLRADRDL-VAKKAKTPVSAAEKSEAGKSAADGG
VRTTGSSNPTPPPSPPFIATPSPELIQNVLGGFSERCAKDGHWLMGLPNFNELGESSHHG
PNLCLNDLKYRHPLSSIGDELEKVLITPD----LEKEFLEENDLMSSWTALDV-------
------------------SA-AQTASLARLQRGVA------------RKALRALCTQRK-
------KS------------------------------------------LDRIAKLEKD
RDYLRCKLD-------------------------RMADEKKITTDL-------VRKLSGE
KKEL-SEEKKLLTEEKKKLLAHVKAFERKI----------------------------IE
YQDVARQRAESE------------------------------------------------
--------DKMKEQVEVLEKKNKELELACKNQSEKISALE--------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------LESESCRQLLLKSCETVR---------------------ITLRSLG
ADISLLSE------------ENTLAAVGKW----FEEFS-----------IGLKDSVTPF
ASRCSKTAVESLSACLL-------SNGC--------------EHFTTLKTDIQGILNDEA
----------------KFAQLRDAAQPVV----------------KAFQVLYWKKKGYED
TLSFSDGNEAIDMTVYVTLYLSLGNGVRTILLLVKPFGKTSNHPNA--NVEYGKGVIQ
>gi|42568127|ref|NP_198299.2|	   761 residues, 50 /line  myosin heavy chain-related [Arabidopsis thaliana]
MNFEI-ERPES----------PSFDDVGS-------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------SNNLCTRS-----------------------------NDIAG-PHYQS
TCTLQSLNRLGELCR-IPAEVMKDLQTPEPTES--PEDHRP-----GFFCVYEIYFKGC-
----GLTFPLPEALVRYLA---ALEIALPQLTPNLLWTILGIITIAAE-----AGYVIGV
PELNELLNVR-------RSS-KKVGY--FSAYPNAN---RNLISHL---PNKD--ENEHH
PWFLVK--KS------PTSIG---NLPDLLPSKWT----TKPA--FIAPTLSTVEFGE-F
FKIVIEG----ETLWNSF---TFDR-FIEANHKLRMRPPGHLLQLPLPPPLPQ-------
----------GTSARAIAARRKTLSKSIV-EACETNKTFLQSAVDKK-------------
--------------------EYSRTLLVDDGSAEGARSAGAYRPTPHRE-----------
------------------------------------------------------------
--------GHSGRLSHRERSPHRDSPRPASRTGLSSERLADLIQKKRDRSTGDSSSPKRD
KTRAQ-------------------------------------------------------
--------------------------------------------------------TDRS
PRLSAPSRSMGPPP---------PVTVSPSSGSGDAGTKVILV-----------------
------------------------------------------------------------
-------PQTKSLTAMETEG-NVFRCFKTRKDTIL------PAFDRWRPANN--------
------KLNDMIEYYERLLLDREKEVMTWKDNYSSLESDLRSSNDARQKLEDQLDNLSSE
LMKSNGELQDQYQRYDKIQEELSTARDTLSESESSAYDLSNQLSELQLKYQAVANYRDAK
LARSASKARKEVKGRGMELIQG----AIIFIQTEKVRTELESDIKEYESNLLLLDQTHED
DFSEKQERNELKTVLEEKRSRLAVLPSSSFNPQQFE------EFYTESPPLDQSG-----
-------------------------------------PSDPMEPEAPIVPVTIPEAVAIP
PELPPS------------------------------------------------------
-------------ANSEKVVIEDDDGSDSGVPSEQPTTGESGENKTVAADPEPAQP----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------ELGVPEN---------------------------
---------------------------------------------------------L
>gi|4733986|gb|AAD28666.1|	   862 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------MLMG-PPSYE
LLLL-------VPQS-LAGSELMM-RDPTPTIS--PPS------------LSNCYSSSEG
FNVLRTKIVPNDSPISRLNYVIELISESPSIT---RVTLVAIMTV----------YYLFT
IKAGKLFHDF---------------------QGGSV---IITGSHL---PNKD--ENWHH
PWFLVK--KS------PASIG---NLPDLLSSKWN----TKPA--FIAPTLSTVEFSE-F
FKIVIEG----ETLWNSF---TLDR-----------------------------------
-----------ESARAIAARRKTLSKSIV-EACEVNKSFLQSTVDKK-------------
--------------------EYSRTLLVDGGSADGTRSAGAYRPTPHRE-----------
------------------------------------------------------------
--------GHSGRSSHKERSPRRDSPRPTSRTGLSSEPLADLIQKKRDRSTRSSSSPKQD
KTRAQ-------------------------------------------------------
------------------------------------------------------------
--LIAFLGHRRHPA---------IWTLIPS--------RYYLV-----------------
------------------------------------------------------------
------------------------------------------------QVNS--------
------ELNDMIEYYERLLLDREKEVMTWKDKSSSLESDLRSSNDARQKLEDQLDNLSSE
LMKSNGAVP--------------------------------ELSELQLKYKAVANYRDAE
LARSTSKATKEVKGR---------------------RMEMESDIKEYESNLLLLDKTHED
DFSEERERDELKTVLEEKRNRLAALPSSSFNPQQFE------EFFTESPPLSESG-LHWA
DNCLG--------------------------------VSDHVEPKIPIAPASIPEAVVTP
PQIPPS------------------------------------------------------
-------------TNSETVVIENDDGSDSGVPSEQPTTGEPDETETTDADPEPAQTEPEV
VDKYRRLCDERQRLGLKRQTLETRIARIERKVRAMENDHFQWEWRNFDCVAKIQHMLRMY
--LRARGQVPGTVKAPVKVIPSN-SEDGDDEEEDSNPWKRVKNEPDVDVKNEISSLGFSS
FLTNNTVLFFRAYGLQPPMLGI-HAKLFEDWDDRG---GHSERTRQRMLPTLQLQ-----
--IPDPSSVCVNQGPFEQR-----SGHRDV----LYQ----------------------S
SRGSTKKRSTEKKK-----------------------------------------LRKKI
NQMLQRVTVILRELH-TLNSHPGDWIELGIAEFARIPDCMMPILDIASQGVEVFYKT---
------------------------RRI------------------------------S
>gi|77553844|gb|ABA96640.1|	   889 residues, 50 /line  Transposable element protein, putative, Transposase_28 [Oryza sativa (japonica cultivar-group)]
MGKSVKKSVKKPKTKKAS------SGLGPSIFSEKRLRKLL----KKG------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------AI
ADAKLVIR----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------PVDESG--P-SPHP-----GYTLVFEDFF-EA-
----GFRFPCSSFVVEVLG---LYGIEFPQLTPNAVV-RLGVFEWIIRSCGGTPHGSDFA
YFHTIRRYTK-------QNTQ--FGCVSFTPRSNRGCPWPLVSTMR---TK--WGSKWQS
KWIYHK--IPADLKA----MEKCPFVFSCKDPEVI----SEPAVNLSKNFSSIRSRIEEL
V-SKFSV----RDLVEEF---ICLG-IRPLSS----------------------------
--------------GWTLTLGEVPQDSTS-ELPPFNIPV---DTKIVKDL----------
--------------------------DGPCRKFIGPYTKKEHT-------KYLELQQDGE
SDSSGECSDDSDS-----------------------------------------------
--------SESSEHAHSAPSVQETSSRKLKRKK-----------------ILSNSPVYSS
LKKVRIAIDSDDE-DDNILSYELPAVDKMVEVETGNTSVANSPPIVIDNLFVPFDVLASM
ANEVEKDVHVDSVDVD------MSLASPVRVENVLEVANLN-------------------
-AQPEKNLADDRGLEPFIMTPSPELIKDVFGGFSERCSKNGTWLMGLPDFGADGESSSRG
PKFCLDDLKYRSSLHQFGNEIAPNLITPE----LEKEFIEHNDLISAWTALDI-------
----------------------------------------------------STLELDF-
------SAELLKRLFSRFALEGKNLLNELQNLKGI-------VQRRRKSNLNLLDKLKKK
KLPLTGNAR-----------------------------------QQLFKSCNLIG-----
------------------------RALKKLGAEPAQFDEDGELSVL-----------NSW
MSNAAASLSS--------------------------------------------------
------------------------------------------------------------
----CILQFASQCSRVACETL---------------------------------------
-----------------------CAALYSSG--------------------------CSH
LANLLTVVPNLLLS----------------------------------------------
------------------------------------------------------------
----------------EANLDRTREIVRPAAKAF-QLLFWKKRGYEDTISSLAASLADSN
TQGGQSSSSCQ---GNDSTT----PQVASKRKSVIHRVG-----------PSENKNLKHI
AFRAPTKSSPRVFYQSEDKIYYDDTCVFAFKFFSWQKRHRDGSLRDFALEFG--------
---NRRLKDNSNSTE-----FWNNFQP---------------TER--------------Q
LRIRKRRYSIVPYIGEPTPLQVILPS-------------------------------E
>gi|77554146|gb|ABA96942.1|	   848 residues, 50 /line  Transposable element protein, putative, Transposase_28 [Oryza sativa (japonica cultivar-group)]
MAFTIG--------------------------------------------------LRPN
GYDVFGLNPRWFLG-----FGKPGRRASWHAANKPL------------------------
-----------TGKGEIWYLRLC-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----VLSCLSTSPLLSPQTRWLLASLRRLGR------------LAKTLAALARGGHA---
--------------------------------------------------SLANHLSRRP
PWPSLSF-----------------------------------------------------
---SGVLAEDQATCGG--------------EAV--VRSPGD-----GQTVVFAAFF-AA-
----GLRLPCDDFLPSVLE---MYEVRLSQLSPLVFL-KLTVFAWMCRT-CGFDPTAELF
AVLFTVTTKDVSTLAGPKRTV--FGCVNFILHPERSYA-WLVPASM---VK--WERNWIQ
KWFYIN--NPYSAKDSKANWLRFEHLVVLIASK------PSVE--LDGVLESRLILLRKV
-VRWLGT----HDLCEEFCLLVNGG-CPLMRTK--WCSGFPASLLPLESSISSL------
------CLSA---PSLGGRANRVHFG----------------------------------
------------------------------------------------------------
-----ELPGRSIPAKAGDDDVGMSRKRKRAVTKGGQVRSRRATKDTAE---------HGG
EEEEDDREAGSEDDGSRGYTPSPTPAKSG------------------------------A
GSHVSSIRPQDVAVANTLLRISSTA-----------------------------------
---------------------------------------AKLGSVARGKKKKGKVVQIGR
AFSDSEG-----------------------------------------------------
---------------------------SDGTPTSPVLQRAPSLGRRTSPP--PASDT---
--EAATGGSASVPAAGANVS-EDERGLAAHL-----------------------------
---------SAKKSALEMLDGYRLWLRKAVDD-------LRHKEDERRVMADTLRKANAE
NNSL--------------RADLEAANRRGTEHDRQLAAAEERIRSLEACLVSAEA-----
--------------------AASTHVPVTESAKQACYTLRLALNDLGTRAEGAPGDD---
------------------------------------------------------------
---------------------------------------------GMAFDFSEWTQEAAG
SVVEVAGAYGDCCARVSAGFVLSLLHAHG-------------------------------
--CEHIKDFPDHVTEEWPLNSQCS------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------GVALKAFRKGFWEDGSWDCEEGI
AKDEEAAAAHT---GGDPGL----SEPAAE----HEGEG-----------NR-GQDHPEA
CGRK---------ACVR-------------------------------------------
--PPTGDWRKENEKF-VAVKGLPKVRRPLRPVYR----------EMLINGNSYQV-----
------------------------------------------------------VKVA
>gi|8388609|emb|CAB94129.1|	   798 residues, 50 /line  putative protein [Arabidopsis thaliana]
------------------------MSSSQSPSTPSAS-----------------------
--------------------------------------------LVDSSDSKHPDDL---
--------------PQIYKRR---------------------------------------
----------------------------------------------------------SV
WTSSEDAVSSSNSP--EQTTPFTVREDTNA------------------------------
--------DIARELDLPDDPEPHLVRR---SSAPMVDE-----AGTSNWQDASEPLMPTV
KIE---------------------------------------DFLYF-------------
--------------------GPNETEDILRLNEQKAFEKAEKKKRKKKKKAVMPNPPGSS
MCTEQSLSDLKARFG-LG-AV--TLRVPSPEER--ADSPPA-----GFYTLYEGFFYGC-
----LLWLPIPRLVLEYVT---SYQIALSQITMRSLRHLLGILIRSYE-----SETEITL
AHLRNFLEIR-------RVPKSEVDR--YYISPAKG--KKIIDGF----PSKD--EPYTD
HFFFVA--IE-----DA----IHEDLLGTVLTRWG----ILE-RTLKFLEPIPDDFLSAF
HALSARK-----------------------------------------------------
--------------------------------------------------CDWLKHFSRE
RVECALRLLHGVSCPTSSESSDHRTQFFVDMQST--------------------------
-----KLTLREVYAKKKEDKERRLAEERRLVNTG--------------------------
---------------LISPRADPEATQDGNVIPDATAPQTAPEASRDGVNPYTAGPVDAA
PAEAQGAEPSAAAPEA--------------------------------------------
-----------------------------------------------VLALPAIDKAAGK
-RIRVDDVSSKKKK---------KKKKASGS--------------EVEKILPIFEDRTAS
ANLL-----------------GGCVGP----LLPPPDTLLESRKYAETASHFL-------
----------------RAVA-SMNRMVHSYDSAMRSNMEVAGKLAEAESRIQAIEREKNE
ALSEAAAAKLEKEEVERTAHVNKENAIKMAE-----------------------------
----------------------------------QNLKANSEIVRLK--------RMLSE
ARGLRDSEVARAVQTTRR------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------EVSETFIAKMKNAEHKVSLLDEVNDRFMYLSQARANA
QLIEALEGG---------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------GVLESEK
EQVDEWLKDFADAE-------------------------------VNLNRFMSELKDDLK
APAPEPAPL---------------------------------------------------
--------------------------------------------------------SPGG
HRSVESLADEAG------------------------------------------------
---------ITDQAGSLLPAKDNRPS----------------------------EDLD
>gi|77554567|gb|ABA97363.1|	   755 residues, 50 /line  retrotransposon protein, putative, unclassified [Oryza sativa (japonica cultivar-group)]
MVEE-RESFE--------------SQWAPSDVTVESLKEMV----AHG------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------VL
PAKEIIGW----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------RSAYDEAFP-TPDT-----HEVMVFSYFF-YG-
----GFSLPTSRFFRWILD---FYGISLHHLNPNSIV-HIANFIHACEAFMGVRPHFALF
CYIFFLKPQPNKS-KP---CV--VGGAGFQLRGTLS--QKYLSMPF---KTSN--KGWHA
NWFYVQ--NPEPALP---EYSCLPPVYQDTWNSLL----MGKE---AAQALALMDCMLKL
KEQVVVS----YSHLLPV---VPYNAFNPPPAEF----ALMKLDPPTAQRRSPR------
------RQTG---QAGGGPNIRSDSQPST-TQSANQ---SDFCKRKLVL-----------
--------------------SDDKNDDSEKVGSKG-------------------------
------------------------------------------------------------
-----------------------------------------VTGKPRRQANPKKKTS---
---------------------------------------SRPMPKIRKSSKKPSDIDPSG
KDSEPTDMETGPSKETEPTAEDRPSDNQPATDNVETSDKPPTGNQSAE-AGVGANQEPST
-GNQSGTEQNN-------------------------------------------------
----------------------------------DISEVETQPDSPPKASAGANSGTNSP
VRVQGPARPRPEIITEDKEVCLLKKTLGQATRLVN------------------------R
IHLRNEAKTATLEKLVPHLGTLEATRNQLHEAKEL-------ARKTEHDLRDRIAELQDS
NFELSGSSKVQAAKISELEKRIQ-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------ALEKDKAELARQRDLALKDVEVQAAKISELEKRIQA---------LEKDNA
ELARQRDLALKDVEDRKI-----KSQAQFDVLVNKIK-----------------------
----RLEGARDEVANAATPLVQ--------------------------------------
------------------------------------------------------------
----------------------------------------------------AMFFNNNG
PSTFDASEIFDKLR-------IALDTYFKNI-----------------------------
------------------------------------------------------------
-KEAGSMGASLALAMTK--------------------SLYPKIDIDAV-DGFADGTSEEA
----------------ALD-LINDAQK---------------AADKI-------------
-----------------------------VVDVVERFQDNDLRPTGSNNSDDEKTDTD

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.