FANDOM


>gi|15226655|ref|NP_178822.1|	   175 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
-MLH--ICVD----F--RGRVG--------------------------------------
-------ASRSQET-TRPPGRVEDIT-T--------------------------------
-------SLH-HSTTRSS-----------------------------ALISITRSH-HST
MRSSVFTSIIR-QP---------------------------------------LDLVNQP
GSRVS----PDKHLITSLDHEVECLHLHCQTTTRPHCSTWKSSITITPLDCIL-------
-DD---KLQSL-------------------------------------------------
-----LHSALNQTL-------EHR------------KGKKTPA-----------------
----------THSTSHSTT-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------WVEYSS-
------------------------------------------------------------
----------------LSVPILRRFEY
>gi|121914130|gb|EAY18932.1|	   309 residues, 50 /line  conserved hypothetical protein [Trichomonas vaginalis G3]
MDEITDGLGKSKSFSFCVYFMHQYATARITNTLGNQKVNVYDGTFKQLAYNEHLDITIQS
GAVKGMM-----------------------------------------------------
----------------------------------------------VGRDNSNNLFFTFN
NIQGNHGWQQMGDER---------------------------------------------
-------VLP-PRTPFGTPFFTPEYTS--------------------KETPFSTAH--ST
PYLTAFRTA---------------------------------------------------
-----------------------------------------------------FSTPFKT
A-----------------------------------------------------------
----------FSTQHSTPFST------------PFMTFIKTPSQTDSS------------
--------------------------------QPEPTLEPPTPSVTSET-----------
-ESKSSPNPLIPVRTIETTPEATWDGQYDDPPNVIIRGDDIPEIHETHPPIQTNFIKTDV
PKKTTYVNVSVGTILIVVVVTLTVVNVVRSYKRI--------------------------
---------------------------------------RNGLNDYQADDVDDLSIESEF
FSSYE-------------------------------------------------------
-----------------------TDDY
>gi|123431276|ref|XP_001308102.1|	   309 residues, 50 /line  hypothetical protein TVAG_078610 [Trichomonas vaginalis G3]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------MTAVPTAAET------------------------
-PFTTVFQTA-ANTPFDTV-FMTAFRTAEE----------------TLFKTVFETA-KET
PLNTAFETF----KETPVIT------------PSLTNKETPFE-----------------
---------------------------------------------------TVHLTPFST
F-----------------------------------------------------------
--------------VETPYKTPFLTSKETPFSTVKYTAKETPVETVKFTEKE--------
--------------------------------TPVET-VFMTPKSTFEP-----------
---TNIPRTPQE-TNPPQTPGETPNPTTPVPSNSPL-PENINYANEDPK-------YNSK
LKAATWGGISAGVVIIATIITIVIIKFRRKS-IIRVQKIEAKT-----------------
---------------------------------------ENSVATDSY-----------D
FSSEEFMPNEPFDIKGDEEVQPESEVFVGEHQR------ENESDIVLDIPELKVN---DS
IVD-------GAF---KQNNNINYMLY
>gi|123417974|ref|XP_001305222.1|	   318 residues, 50 /line  hypothetical protein TVAG_108090 [Trichomonas vaginalis G3]
--------------MQSNGSKPVCENTG--------------------------------
-------------------------------------------KAIKRTSTDDY------
---------------------------------------------------------AYA
RISNTLTQDPQTSDVESPTEYTYVATP---------------------------------
--ITRLPKQT-TESYVYP-SAKTLEKD-LF-PFEFSGYSVIPTNA---------------
----------------------------------ITPHSTPHST----------------
---------------------AHS-------TPHSTPHSTAHSTPHSTPFSTAHSTPFST
A-----------------------------------------------------------
--------------HSTPFSTAHT------------TPHDTPFSTA--------------
-----------HSTAHVTPFT-----------------------TPFSTAFVTVFETP--
---FGTPFITNF-ATAASTPQTTANTTPELTPSATPDP----------GNAIDSNPKSIS
KT-GVIVGVVIGCLIFILLVALLAFYLYKRSKNDVSESSHEISQMSE-------------
------------------------------------------------------------
-------------------------------ETDPGNVENEPTMTSLNIQQNPDE-----
------IISSSDEPQEKEDNTLTDVFF
>gi|15227386|ref|NP_178874.1|	   151 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
-MLH--ICVD----FSQ-------------------------------------------
----------VDASRHQQTTRPR------------------------------------G
RVEDLSTSRH-HSTPWSS-----------------------------TTWTTT-------
----------------------------------RSHYSTPWSSIITSTTSPSLDHTTQP
RGRVPSSP---------------------------------------SLDHS--------
------------------------------------------------------------
--------------TTKPSTTIPITRLHTRLPASES------------SPFCTQPDTRAE
GRKEDSSLSLDHSLDH--------------------------------------------
------------------------------LGRVPFLI----------RRN---------
------------------------------------------------------------
-------------------------------------------------------TTSF-
------------------------------------------------------------
---------------------------
>gi|4773910|gb|AAD29780.1|AF147259_3	   267 residues, 50 /line  F10A2.13 gene product [Arabidopsis thaliana]
---------MA-------------------------------------------------
-----------------------------------------------------------N
VSKHLGSSCIRIACFGV--FSG-----------VEGAKKDFT------------------
-----------RSI-HSIQAATEEASIH--------STSLLDPGCYRGGYSLLDPLTRSR
QPQMKQQIDL-LAPPTRS-IYSTTAVDELI-GRSGPDRIKPLDPLSSTCFTTSTNH--ST
PSSSRRPRHF-APPLDHMAEYHQLHHLT----ITRSHHSTPWSSTSITFTRSLTRLHGRP
SITISIT-----------------------------------------------------
------------------------------------------------------------
-------------------------RIYTRLPALES------------SPFRTQPNTRAQ
GRKEDSSSSLDHSLDHLVEFEPRH------------------------------------
------------------------------------------------------------
---------------------FR---AQKVFDEMSEPLIPEIRGSVP-------------
--------------------------------------------------RLTLVNG-D-
------------------------------------------------------------
---------------------------
>gi|15221112|ref|NP_174876.1|	   212 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------MLRTVARESNHISEELLVE-----------KKYDSIRENEASANEFEEEDE
IANNEDDVVTKEAAALEANNDNEKKDDIYIGMEFSSDQIAYITYKKYGGNHGFNVGKQRK
M--------------KK--REG--------------------------------------
------------DL-ELFASKLEETSQN--------------------------------
-------QKT-YSTPWSS-----------------------------DFEAILPIH--ST
TRSSNLSSGHSMTLLDPLVEYHFATP----------SPSLDHSLY----------QVTRP
PG------QVSSLTTIS---------------------------------ITR-------
-PDTRSRLHSL-------------------------------------------------
-----LKSALN-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------
>gi|8778803|gb|AAF79811.1|AC020646_34	   240 residues, 50 /line  T32E20.7 [Arabidopsis thaliana]
---------MSSLMMHCLIHVPELMNVKGIGRFESMCRSSIRDGLIDNKAWLTFLSRIQS
YRILELPTWTMILFALSY---------ALCPFIMVLSPVSYHSSLFYIISHHSCILCMIR
IVLH--TYYI----SEL--FSG--------------------------------------
------------DL-ELFASKLEETSQN--------------------------------
-------QKT-YSTPRSS-DFGAILPTYST-------------PRSSDFGAILPIH--ST
TRSSNLSSGHSMTILDPLVEYHFATP----------SPSLDHSLY----------QVTRP
PG------RVSTLTTIS---------------------------------ITR-------
-PDTRSRLHSL-------------------------------------------------
-----LKFALNQT-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------S
>gi|15235658|ref|NP_192473.1|	   207 residues, 50 /line  unknown protein [Arabidopsis thaliana]
--------------MHCLIHIPELMNVKGIGRFESM------------------------
------------------------------------------------------------
---------------------C--------------------------------------
------------DL-ELFASKLEETSQN--------------------------------
-------KKT-YSTPRSS-DFGAILPTYST-------------PRSSDFGAILPIH--ST
TRSSNLRSGHSMTLLDPLVEYQFTTPPDNTRPFTLPHHSTPRSSI----------TSPHH
HH------HSTIHSTKLLDPLVEYHH----------------SPPSASLDRTL-------
-DH---VFTVY-------------------------------------------------
-----SNPHSTRQA-------EHK------------EEKR--------------------
----------------------RRQSVWKRPGLPSDHEAH--------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------LGPLSLYG--
------------------------------------------------------------
------------------------PSD
>gi|22328390|ref|NP_680613.1|	   193 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------MIR------------------------------------------------
------------------------------------------------------------
ITLH--TYCI----SEL--FSG--------------------------------------
------------DL-ELFASKLEETSQN--------------------------------
-------QKT-YSTPRSS-DFRAILPTYST-------------PRSSDFGAILPIH--ST
TRLSNLSSGHSMTLLDPLVEYHFATLPDNTRPFTLPSYSTPWSSI----------ITHHH
QH------HSTGHSITSSQSTQI---------------------------RTQ-------
-PDKLS------------------------------------------------------
--------------------------------------TR--------------------
----------------------KRRGEDKVFGSGLDLHRI--------------------
------------------------------------------------------------
------------------------------------KKPISAHYLSM-------------
---------------------------------------GRAIRLLARLLSFYFVLY---
------------------------------------------------------------
--------------------------K
>gi|9294211|dbj|BAB02113.1|	   174 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
---------M--------------------------------------------------
----------------------------------------------------------IR
IALH--TYCI----FEL--FSG--------------------------------------
------------DL-GCWRGNWKKR---ART-------------------------RRHT
RPPGRVHPTP-YSTPWSS-----------------------------DIGAILPIY--ST
PWSSNHSSGHSMTPLDPMVEYHY---------------TTPLD-----------------
-------HHSAIHSTTSLNPLVEYHH----------------STPTPSLDQTL-------
-DH---IFKVY-------------------------------------------------
-----SNSHLTRQA-------EHK------------DEKR--------------------
----------------------RRRSVWKRSG----------------------------
------------------------------------------------------------
------------------------------------------ASSDH-------------
--------------------------------------------------EAHLGPLSL-
-------------------------------------YGPV-------------------
--------------------------D
>gi|15226148|ref|NP_178814.1|	   150 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----MSS---SSVIMDFLKYSPQPLQL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-ITRPRHSIH-HSTLRSS-----------------------------RRLTTSHNH--ST
PRSSSSHHHFS-PSLDPVAEHH--HHQS----LDR-----------------TLDLVVES
PH--------HHSLDPSLCHQVEFHH-------------------HPPLDIIL-------
-DC---QLQSL-------------------------------------------------
-----LDSAINKTL-------EHK------------EEMKTLA-----------------
----------RHSTHYLIT-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------WVEYHS-
------------------------------------------------------------
---------------------------
>gi|22329987|ref|NP_683367.1|	   261 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------MSSLMMHCLIYVPELKNVKGF------------------------------
------------------------------------------------------------
---------------------G--------------------------------------
------------DL-ELLASKLEEESRN---------------------------QKPHT
RPPGRVHPAP-HSTPWSS-----------------------------NIGAVLANH--ST
PWSSNHTPGYSMTPLDRIGKQHF---------------VTPLD-----------------
-------NHLTIHSTTLLDPLVEYHH----------------SPPIKSLDQAL-------
-DH---TFRVF-------------------------------------------------
-----SNPHSNRQA-------EHK------------AEKR--------------------
----------------------RRRSVWKRPG-----------------------ASPDH
KAQFGP-------------------------------------------------LSFYG
PK-MFDGMLDP--LVPEILVSIP---RDWPFRALG-------ELTDS-------------
--------------------------------------------------STELGELIK-
-------------------------CKVERVPTNGCIAQRMQGIDVTFRKDAKNG---CD
ISEG------------------CKDRM
>gi|8777504|dbj|BAA97074.1|	   148 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
----MRSSI---------------------------------------------------
------------------------------------------------------------
---V--ILD---------------------------------------------------
------------------------------------------------------------
-------FLN-YSATTST-----------------------------ANHLTTTLYPSLD
LEVECSHHHFS-PSLDPLEGTSITTYRH----SLDPLVEQQHHHLSSFTQSPPLDLVVES
DH--------HHSFDQSLCHQVEFHH-------------------HPPLDIIL-------
-DC---QLQSL-------------------------------------------------
-----LNSALNQTF-------EHK------------EEKRTPT-----------------
----------HHSTHYSTT-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------
>gi|15221139|ref|NP_174879.1|	   104 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MTN-HSTQRSS-----------------------------RSFKISRDH--ST
PRSSRRHHQFT-SPLDHQVE-------------------------------PLLDLITPP
GSRVSP---------------------------------------STPLDYIL-------
-DD---KLQSL-------------------------------------------------
-----LHSALNKTL-------EHK------------EEKKTPA-----------------
----------IHSTSHSTT-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------WVEYSS-
------------------------------------------------------------
---------------------------
>gi|9293995|dbj|BAB01898.1|	   104 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MTN-HSTQRSS-----------------------------RSFKISRDH--ST
PRSSRRHHHFT-SPLDHQVE-------------------------------PLLDLITLP
GSRVSP---------------------------------------SPPLDCIL-------
-DD---KLQSL-------------------------------------------------
-----LHSALNQTL-------EHK------------EEKKTPA-----------------
----------IHSTSHSTT-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------WVEYSS-
------------------------------------------------------------
---------------------------
>gi|9293994|dbj|BAB01897.1|	   112 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MKE-ESSLFAT---------------------------YKENIRQSSYH--HF
SSPSLDH-HSI-TSLDPEVE------------------------CLHPIARPVLDLIILP
GSRVSP---------------------------------------SPPLECIL-------
-DD---KLQSL-------------------------------------------------
-----LHSALNQTL-------EHK------------EEKKTPA-----------------
----------IHSTSHSTT-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------WVEYSS-
------------------------------------------------------------
---------------------------
>gi|18412965|ref|NP_567303.1|	   104 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MSN-HSTPRSS-----------------------------RSFKISTDH--ST
PRSSRGHHYFT-TSLDPEVE-------------------------------PLLDLITLP
GSRVSP---------------------------------------SPPLDCIL-------
-DD---KLQSL-------------------------------------------------
-----LYSALNQTL-------EHK------------EEKKTPA-----------------
----------IHSTSYSTT-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------WVEYSS-
------------------------------------------------------------
---------------------------
>gi|30693479|ref|NP_849763.1|	   150 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MTN-HSTQRSS-----------------------------RSFKISRDH--ST
TRSSRGHHHFT-SPLAPRSS------------------------AIISITRPSLDHFTRP
RGRVPSSPSPDRHSITSLDHEVECLHLYHQTTTRPPHSTQRSSISITPLDSIL-------
-DD---KLQSL-------------------------------------------------
-----LHSALNQTF-------EHK------------EEKKTPA-----------------
----------IHSSSHSTT-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------WVEYSS-
------------------------------------------------------------
---------------------------
>gi|4733987|gb|AAD28667.1|	   130 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
----------------------------------------------------------MH
CLIH--VPEL----MNVKGIGG--------------------------------------
-------FENLCDL-ELLTSYLEEVDLI--------------------------------
-------MTN-HSTKRSS-----------------------------RSFKISRDH--ST
TRSSRAHHHFT-SPLDP-------------------------------------------
---------------------------------------ERSSNSITPLDCIL-------
-DD---KLQSL-------------------------------------------------
-----LHSALNQTL-------EHK------------EEKKIPA-----------------
----------IHSSSHSTT-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------LVEYSS-
------------------------------------------------------------
---------------------------
>gi|22331493|ref|NP_683640.1|	   104 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MSN-HSTPRSS-----------------------------RSFKISIDH----
--------------------------------------------------------STPW
SSR------GHHYLITSLDPEVETL---LDLFTLPGSRVS----PSPPLDCIL-------
-DD---KLQSL-------------------------------------------------
-----LHSGLNQTL-------EHK------------EEKKTPV-----------------
----------IHSTTHSTT-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------WVEYSS-
------------------------------------------------------------
---------------------------
>gi|15230833|ref|NP_189692.1|	   206 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------M--------------------------------------------------
----------------------------------------------------------FR
IVLH--ACCI----FAL--ISG--------------------------------------
------------DL-ELLTSYLQEADLI--------------------------------
-------TTN-HSTKRSS-----------------------------RSFRISRDH--ST
HRSSRGHHHFT-SPLDHEIECPHLHHQT----ITRSLHSTMRSSAFTFTARPLLDLVTQP
RGRVSPS-----------------------------------------------------
------------------------------------------------------------
-------------------------QHLTAYSMTSFRAFFIP------------------
-----------HSTRHSSTRKKRRLQIFTRPL-----------------------TRPPG
S------------------------------------------------------STVLN
PS-KYFVVLSI--RVSGYLAISS---MYSSFSQTRSF-----------------------
------------------------------------------------------------
-------------------------LPSFISADLVF------------------------
---------------------------
>gi|22327253|ref|NP_680292.1|	   240 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----MLSKEK--------------------------------------------------
----------------------------------------------------------DH
LVSH--H------------HQG--------------------------------------
------------DL-ELLTSYLEEEDLI--------------------------------
-------MTN-HSTKRSS-----------------------------RSFKISRDH--ST
PWSSRGHHHFT-SPLDHEVECPHLHHQT----ITRSHHSTMRSSVFTSIIRPPLDLVTQP
GSRVSSDTT------------------------RSHHSTPR------PSDFIP-------
-LP---DLYST-------------------------------------------------
-----LSLYLDVEY-------HHH-HHSTAYSMTSFRAFFIP------------------
-----------HSTRHSSKRKKRRLQLFTRPL-----------------------TRPRG
S------------------------------------------------------STVLN
PS-QYFVVLSI--RVSGYLAISS---MYFTFSQTRSF-----------------------
------------------------------------------------------------
-------------------------LSSFISADLVF------------------------
---------------------------
>gi|42573503|ref|NP_974848.1|	   256 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------M--------------------------------------------------
----------------------------------------------------------FR
IVLH--ACCI----FAL--ISG--------------------------------------
------------DL-ELLTSHLEEADLI--------------------------------
-------TTN-HSTKRSS-----------------------------RSFKIPRDQ--ST
PRSSIGHHHFT-SPLDLFTPPGSRVSSN----TTRSPHSTPRSSAFTFTARPLLDLITLP
RGRVPPS-----------------------------------------------------
------------------------------------------------------------
-------------------------HRSTAYSMTSFRAFFIP------------------
-----------HSTRHSSTRKKRRLQLFTRPL-----------------------TRPPG
S------------------------------------------------------STVLN
PS-KYFVVLSI--RVSGYLAISS---MYFSFSQTRSFYLVLFPQTLC-------------
--------------------------------------------------SRLFVIRIS-
-----------------------LYLFSIQLWFLIF---------------VYCCSFC-Y
HTTVTLLLSC------LQPVQRLCFLL
>gi|22327209|ref|NP_680270.1|	   258 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------M--------------------------------------------------
----------------------------------------------------------FR
IVLH--ACCI----FAL--ISG--------------------------------------
------------DL-ELLTSYLEEADLI--------------------------------
-------MTN-HSTQRSS-----------------------------RSFKISRDH--ST
TRSRRGHHHFT-SPLDPEVECPRLHHQT----NTRSRHSTSRSSAFTFTARPLLDLITLP
RGRVSPS-----------------------------------------------------
------------------------------------------------------------
-------------------------HHSTAYSMTSFRAFFIP------------------
-----------HSTRHSSTRKKRRLQLFTRPL-----------------------TRPPG
S------------------------------------------------------STVLN
PS-QYFVVLSI--RVSGYLAISS---MYFSFSQEEVSYLVLFPQTLC-------------
--------------------------------------------------SRLFVIRIS-
-----------------------LYLFSIQF--------------------LYLISFTVV
HSVIILLLHCCYHVFNLFNVYAFCYDV
>gi|29423658|gb|AAO73423.1|	   107 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
---------M--------------------------------------------------
----------------------------------------------------------FR
IVLH--ACCI----FAL--ISG--------------------------------------
------------DL-ELLTSYLEEADLI--------------------------------
-------MTN-HSTQRSS-----------------------------RSFKISRDH--ST
TRSSRAHHHFT-SPLDPEVECHHLHHQT----VTRSLHST--------------------
------------------------------------------------------------
------------------------------------------------------------
-----SSLYLEVEY-------LH-------------------------------------
-----------HTTR---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------L
HTR------------------------
>gi|12321081|gb|AAG50650.1|AC073433_2	   126 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
---------MSSLMMHCLIHVQELMNVKGIV-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------VDE--LT
GRSGPDH---A-KSLDPRT--------S------------------------LLRLITRP
LGRVPPR--------ESLDH-----------FTRPPGRVSSPLPPSPSLDYIL-------
-DV---ELQSL-------------------------------------------------
-----LHSALNQTL-------EHK------------EEKKTPA-----------------
----------IHSTSHSTTL----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------VEYSS-
------------------------------------------------------------
---------------------------
>gi|123337223|ref|XP_001294321.1|	   162 residues, 50 /line  hypothetical protein TVAG_318700 [Trichomonas vaginalis G3]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MHS---T-PHSTPDS--------T----M----H----------------------
-------------------STPHS-------TPHSTPDSTMHSTPHSTPDSTMHSTPHST
PDS---TMHST-------------------------------------------------
-----PHSTPDSTMHSTPHSTPHS------------TPHSTP------------------
-----------HSTPHSTPASTPHS-------TP--------------------HSTPAS
TPASTPATTPAD-T-----PAITENEAA----------------------QAFGSTTFIV
PM-TIVLIVTI--SLI--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------VVF----ALIANQSCWRW
>gi|123480761|ref|XP_001323403.1|	   337 residues, 50 /line  hypothetical protein TVAG_498740 [Trichomonas vaginalis G3]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--MEWCFFAEN--------------------TNAKLQFSSTLTLADCYFDTFV-------
-----FDGNA-ASLTTTR-CDTATQVIPTN------------FPVFQIGSCSISLY--SG
TMSYITD---A-PPITPAQ--------T----MFVTPH----------------------
-------------------STPFS-------TAHSTPASTMHSTPHSTPHSTAHSTP---
--------HST-------------------------------------------------
-----AHSTPASTVHSTPHSTPHS------------TAHSTP------------------
-----------HSTPHSSPYGELPR-------TPVETVA----------PPRTVQETPQE
TTNAVVVIIPTP-S-----PSIDNANLLFETPGGKINT----------LSWLVVTALSAA
VV-GIIVTVVI--CLK----------------RKPKVVIQKIEPKSD-------------
--------------------------------------------------ESTIYEYSES
VQEEEEAPEED-----------VLEIFSLNEEIKPTKEKQREVYKGVYEHDNTDFVLSDT
EDEVDLMQQIDA----MQTKVSTVLIL
>gi|161970|gb|AAA03000.1|	   257 residues, 50 /line  chagas antigen
-----------------------------------------------------EFG----
------------------------------------------------------------
------------------------------------------------------PTISHV
TVNNVLLYNRQLNAEEIKTLFLSQ-DLI---------------------------GTEA-
HMDSSSDSSA-HGTPSTP-VDSTAHGTPST-------------PA---DSSAHSTP--ST
PAD---S---S-AHSTPST--------P----VDSSAHS---------------------
----TPS--------TPADSSAHS-------TPSTPADSSAHSTPSTPVDSTAHGTPSTP
ADS---SAHST-------------------------------------------------
-----PSTPVDSSAHSTPSTPADS------------SA----------------------
---------------------------------------------------HSTPSTPVD
SSAHSTPSTPAD-SSAHGTPSTPVDSSAHSTPSTPAD-----------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------SSANGTVLILPDGAAL---ST
FSGGGLLLCACAL---LLHVFFTAVFF
>gi|71396413|ref|XP_802385.1|	   373 residues, 50 /line  trans-sialidase [Trypanosoma cruzi strain CL Brener]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------TP-STPADSSAHSTPSAPADSSAHSTPLTPADNGAHS-
TPSTPADNGA-HSTPSTP-ADSSAHSTPST-------------PA---DNGAHSTP--ST
PAD---S---S-AHSTPSA--------P----ADSSAHS-------------TPSTPADN
GAHSTPS--------TPADSSAHS-------TPSAPADSSAHSTPSAPADSSAHSTPSTP
ADS---SAHST-------------------------------------------------
-----PSTPADSSAHSTPSAPADS------------SAHSTPSTPADNGAHST-PSTPAD
NGAHSTPSTPADSSAHSTPLTPADSSAHSTPLTPADNGAHSTPSTPADSSAHSTPSTPAD
SSAHSTPSTPAD-NGAHSTPSTPADSSAHSTPSAPADS----------SAHSTPS-----
------------------------------------------------------------
------------------------------------------------------------
TPADSSAHSTP-----------STPADNSAHSTPSTPAGHGATGMVLFFPDGAAF---SA
FSDGGLLLCAGAL---LLHVFVMAVFF
>gi|71399384|ref|XP_802771.1|	   341 residues, 50 /line  trans-sialidase [Trypanosoma cruzi strain CL Brener]
---------VASPLLGASLDSSGGKKLLGLSYDEKHQWQPIYGSTPVTPTGSWEMGKR--
----------------------------------------------------------YH
VVLT--MANK----IGSVYIDGEPLEGSGQTVVPDERTPDISHFYVGGYGRSDMPTISHV
TVNNVLLYNRQLNAEEIRTLFLSQ-DLI---------------------------GTEA-
HMGSSSGSSA-HSTPSTP-ADNGAHSTPST-------------PG---DNGAHSTP--ST
PAD---S---S-AHSTPST--------P----ADSSAHS---------------------
----TPS--------TPADNGAHS-------TPSTPGDNG------------AHSTPSTP
ADN---GAHST-------------------------------------------------
-----PSTPGDNGAHSTPSTPADS------------SA----------------------
---------------------------------------------------HSTPSTPAD
SSAHSTPSTPAD-SSAHSTPSIPADSSAHSTPSAPAD-----------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------NGANGTVLILHDGAAF---SA
FSGGGLLLCAGAL---LLHVFVMAVFF
>gi|123403271|ref|XP_001302207.1|	   171 residues, 50 /line  hypothetical protein TVAG_222310 [Trichomonas vaginalis G3]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------METPMNTAV----------ETVAM
TPVVTA-AETAFETPFSTA-DKTAQETPFSTAVETPALTESSTPFNT-------------
QYQTVFETAFK-TPYETV---SSTQQET-------------------AF-ETPYETVSS-
----------TQHE---------TVV-------------------ETPFETAV-------
-ET---PYETVSSTQQETAFETPYETVSSTQHETVVETPFETAVETP------YETVFET
AFETPYETV---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------SYT-
------------------------------------------------------------
---------------------------
>gi|123426487|ref|XP_001307047.1|	   242 residues, 50 /line  hypothetical protein TVAG_233680 [Trichomonas vaginalis G3]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MPTPFETVYETI-R--------YTDMETPYETIPMTPFVT---------FDVT
PYSTLEYTSKE-TPIATI---HMSPFKT-------------------FV-ETPYDTLSI-
-----------------------TPL-------------------LTPVETIP-------
-MT---PKKSPISTSEYTPFITPDKSPIQTPARTIKIEDGQSIVETRNSDNANSESAEKS
S-----------------------------------------------------------
----------------QKK-----------------------------------------
------------------------------------------------------------
-----YTFMFVGIACFFLLVVIGIVCFALYMRHKNNVEYDSETPEVEPHEI---DEFKLV
MIQKFNIYLFFILLIYELKVVYVEGFCDFFCKRKNSYIFERFCII----------FFYI-
------------------------------------------------------------
---------------------------
>gi|123431663|ref|XP_001308257.1|	   258 residues, 50 /line  conserved hypothetical protein [Trichomonas vaginalis G3]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-MIIIA-PETAFETPFL-------------TSFETPYETASSTPFET-------------
AFQTAAQTAFE-TPFVTA---FETAYQT-------------------AF-KTPFDTAGQ-
-----------------------TMS-------------------ETPFESAF-------
-ET---PFVTAFETAFQTPEITQNNVPPIDPQPSENEGDPDKPTEKP-SENEQGKQSEKN
SANAPFHSVSSSTN-------SGK------------IQEQQTT-----------------
-----------ETASKSKS-----------------------------------------
------------------------------------------------------------
-----WIYILIGVVCVLALIAIIVVVVVLKKKSDNSDSLETEPADDNPETVIGEDEFAA-
----------------EGNTTDVFNLTSSICGDNDPFNVGSDLESDSVNEN----YVFI-
------------------------------------------------------------
---------------------------
>gi|42573505|ref|NP_974849.1|	   123 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------M
DLIISI-YSTL-------------STRSHLRSQSLDRNTL------V---------HHST
PWSSRRHHHFS-PPLDTLVEYHHLYHST-------------------FTRSPPLDYIVE-
-----------------------YHH-------------------HPPLDIIL-------
-DC---QLQSL-------------------------------------------------
-----LHSALNQTL-------EHK------------EEKKTPA-----------------
----------YHSTNHSTT-----------------------------------------
------------------------------------------------------------
-----WV-----------------------------------------------------
-------------------------------------------------------ECRS-
------------------------------------------------------------
---------------------------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.