Fandom

Proteins Wiki

At2g09865.1/MSA

< At2g09865.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|22325581|ref|NP_671810.1|	   339 residues, 50 /line  unknown protein [Arabidopsis thaliana]
--MTGQK--------------KKARKSVPPPSSSAAAHHRRTFSTAA-------------
-----------------ERILSQRVWEKDVNKEFTKEILPTWFA-DFGLMQRLQIEKSVL
GLLDDIGNA-------MLRKELLSTSFAVSDRVYH-------------------------
----QEICVTSMVLTMISLE--------------------FPCLNS-------LRMLRLI
TSTLLCKMKPGKMRLSMLLLLYHAVHDFFPDSFGVEEVVRDVNFGVVFAHHLVSLKTKPF
TRKRKKSKRVGSLLTPIFEHFCISFEGEERQTR---------------------------
-HHMIQLPCPALTEITGEHEEIGFHHDPS----------------RSAPTKTEDEFIDPV
GGPRVGSSSLALPYELPSPTPIPIEPYVFQQYIVDSFKSVWNAIATLSRCGCVASTRRRH
RSPAPTSRSEHED
>gi|15228450|ref|NP_189793.1|	   230 residues, 50 /line  unknown protein [Arabidopsis thaliana]
MVLIDTI--------------RVSIDTIRVSID------------TIIF------HY---
------------------------------------------------------------
----------------DLYHELVR-QFMAFVRVYYVNDRKRNAQEGALIFFILSVRYSLP
LRVLCDIYGFDNDLTGVSLLGQFKDAQIFWSRFGNGIYDSKDAVHSEIRHPVLRYL----
-------------------------------------VDRNVNFGSVFAHHLVSLKTKPF
TG----------------------------------------------------------
-----------------EHEELGFHPDPSLLHSAPRTMKHR-------------------
----------ALPYQVPSPPPIPMEPHVFQKYVVDSFKSVWNAIATLSRCGCVAPTRRRR
HSPALGA------
>gi|22329979|ref|NP_683363.1|	   378 residues, 50 /line  unknown protein [Arabidopsis thaliana]
MVSIDTLIFQALNSSKFHPLYSPSINSINLQDDWAEKEGKEELSSILLL------HRKAS
PPPPISALP---------------------NRNHKL-------------------QPLNL
LFIDFPGQS-------FQQRERFR-QFTASVRVYYVNDRKLNVQEGALIFFVRGVRYSLP
LRELCDIYGFDNDLIGVALPGQFKDAQIFWSRFSNGIYDSKDAVHSEIRHLVLRYLVRLI
SSTLFCKMEPGKMRLSELLVLYHVVHDFFPDSLRFEEVDRDVNVGAVFAHHLVSLKTKPF
TGRGKKLERVGSLLTPIFEHFRISFEGEE-------------------------------
------LPCTALTKITSEHEELSFCPDPSLMHAAPRTRRHRGLASRSAPTQTEDEFIDPA
EGLRVGSSSSALPYQLPSPPPIPMEPHVFQQYVVDSFKSVWNAIATLSR-----------
-------------
>gi|15235731|ref|NP_192493.1|	   239 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------------------------------MAAHPRRSFSTAAGLRPSQPEAPVAA
PLPPIYRFP--WPISPKEKIPSQRVWEKDINR----------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------EFTNDSLGFEEVDRDVNFSAVFAHHLVSLKTKPF
TGKGKKSERVGSLLTPIFQHFRISFEGEEVNTTRFTMDETYLKNSHWLKGNLLWT-----
---------------------------------------QRGSSSGSAPTQTEDEFIDPA
GGPRVGSSSSALPYELSSPPPILMEPQVFQQYVVDSFKSARNAIATLCRFGCVAPTRRRH
RSPAPTSGLEHED
>gi|22327306|ref|NP_680317.1|	   425 residues, 50 /line  unknown protein [Arabidopsis thaliana]
--MTGQK--------------KKARKSVRPSSSSAVPHHRQRFSTAASLLPSQPESQAAA
PQPPVHRFP--WPKLPNERIPSQRVWEKDVNKEFTK-------------------EKSVL
GLLDDIGLETICCRLYFLYPELVK-QFMASVRVSYVNDRKHNAQEGALIFFIRGVRYSLP
VRDLCDIYGFDNDITGVSLPGQFKDSQIFWSWFGNGIYDSKDAVHSEIRHPVLGYFVRLI
SSTLLCKMEPGKMRLSELLLLYNALHDFFLDNLGFEQVDRNVNFGAVFAHHFVSLKTKPF
IGRGQKSERVGSLLTPIFKHFCINFKGEEVNTTCVIMDEAYRKNSHSLKGNLMWCFRDDT
CQHMIRLPRPALTEITGEHEEIGFHPDPSLLHAKPRTRRQRVSASGSAPTQTEDEFIDPA
GGPKVGSSSSALPYQLPSPPPIPLEQQVFQQYASTISRASRTP-----------------
-------------
>gi|15231519|ref|NP_189716.1|	   80 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
---------------------------------MR-GLLPKEFGIRISTENSQKIEKSIL
GLLDDIGVGTIGFRQYDLYPELVR-QFMASVRIYYVNDKKRDAQEGALIFFIHGV-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------
>gi|5732027|gb|AAD48928.1|AF147259_13	   276 residues, 50 /line  F10A2.21 gene product [Arabidopsis thaliana]
--MTGQK--------------RRRGRAL------DLPPPLPPLTTASASPPPPLTTASAS
PPPPVSDHPNRNPKLQ--PLNHLFIDFHGQSFQMR-EYLLKGFGRKMSTGNSLKIEKFVL
GLLDDIGLGTICCRQYDLYPELVR-QFMGSITVSYVNDRKLNAKEGALIFFIRGVRYSLP
L--IC---VTSMGLTMISL------------KFGKGIYDSKDAVHSEIRHPVLRYLVRLI
SSTLLCKMEPGKMRLSELLLLYHALHDFFPDNLG--------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------FEQYVVDSFKSVWNAIATLSRCSCIAPTRRRR
RSPASTSDSKHED

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.